Edit tour

Linux Analysis Report
g.elf

Overview

General Information

Sample name:	g.elf
Analysis ID:	1583726
MD5:	b6cc75734e37475256f2f96207a4a6e0
SHA1:	e27f901a35aee1be603caccb40e49c81f8e3145d
SHA256:	7a2f1b7505c6e2942f1bbd1a48b35687822c5deb11563008db3217266e84d3d4
Tags:	androidelfmalwareuser-Joker
Infos:

Detection

Score:	64
Range:	0 - 100
Whitelisted:	false

Signatures

Antivirus / Scanner detection for submitted sample

Malicious sample detected (through community Yara rule)

Multi AV Scanner detection for submitted file

Sample has stripped symbol table

Tries to connect to HTTP servers, but all servers are down (expired dropper behavior)

Uses the "uname" system call to query kernel version information (possible evasion)

Yara signature match

Classification

General Information

Joe Sandbox version:	41.0.0 Charoite
Analysis ID:	1583726
Start date and time:	2025-01-03 13:09:24 +01:00
Joe Sandbox product:	CloudBasic
Overall analysis duration:	0h 4m 45s
Hypervisor based Inspection enabled:	false
Report type:	full
Cookbook file name:	defaultlinuxfilecookbook.jbs
Analysis system description:	Ubuntu Linux 20.04 x64 (Kernel 5.4.0-72, Firefox 91.0, Evince Document Viewer 3.36.10, LibreOffice 6.4.7.2, OpenJDK 11.0.11)
Analysis Mode:	default
Sample name:	g.elf
Detection:	MAL
Classification:	mal64.linELF@0/0@0/0

Runtime Messages

Command:	/tmp/g.elf
PID:	6226
Exit Code:	2
Exit Code Info:
Killed:	False
Standard Output:
Standard Error:	fatal error: sigaction failed runtime stack: runtime.throw({0x941df6, 0x10}) /usr/lib/go-1.23/src/runtime/panic.go:1067 +0x48 fp=0x7ffffce4 sp=0x7ffffcd0 pc=0xada10 runtime.sysSigaction.func1() /usr/lib/go-1.23/src/runtime/os_linux.go:535 +0x4c fp=0x7ffffcf0 sp=0x7ffffce4 pc=0xa2b04 runtime.sysSigaction(0x41, 0x7ffffd18, 0x0) /usr/lib/go-1.23/src/runtime/os_linux.go:534 +0x7c fp=0x7ffffd08 sp=0x7ffffcf0 pc=0x59a34 runtime.sigaction(...) /usr/lib/go-1.23/src/runtime/sigaction.go:15 runtime.setsig(0x41, 0x7eea8) /usr/lib/go-1.23/src/runtime/os_linux.go:482 +0xbc fp=0x7ffffd34 sp=0x7ffffd08 pc=0x59900 runtime.initsig(0x0) /usr/lib/go-1.23/src/runtime/signal_unix.go:148 +0x2c0 fp=0x7ffffd70 sp=0x7ffffd34 pc=0x7e1a4 runtime.mstartm0() /usr/lib/go-1.23/src/runtime/proc.go:1858 +0x70 fp=0x7ffffd78 sp=0x7ffffd70 pc=0x6577c runtime.mstart1() /usr/lib/go-1.23/src/runtime/proc.go:1830 +0x94 fp=0x7ffffd88 sp=0x7ffffd78 pc=0x65674 runtime.mstart0() /usr/lib/go-1.23/src/runtime/proc.go:1791 +0x7c fp=0x7ffffd9c sp=0x7ffffd88 pc=0x655c0 runtime.mstart() /usr/lib/go-1.23/src/runtime/asm_mipsx.s:89 +0x14 fp=0x7ffffda0 sp=0x7ffffd9c pc=0xb4e10 goroutine 1 gp=0x1400128 m=nil [runnable]: runtime.main() /usr/lib/go-1.23/src/runtime/proc.go:147 fp=0x14407ec sp=0x14407ec pc=0x60984 runtime.goexit({}) /usr/lib/go-1.23/src/runtime/asm_mipsx.s:664 +0x4 fp=0x14407ec sp=0x14407ec pc=0xb7290

Process Tree

system is lnxubuntu20

g.elf (PID: 6226, Parent: 6142, MD5: 0d6f61f82cf2f781c6eb0661071d42d9) Arguments: /tmp/g.elf

cleanup

Yara Signatures

Initial Sample

Source	Rule	Description	Author	Strings
g.elf	tool_gost_tunnel_strings	Detects GOST Go Tunnel, based on strings	Sekoia.io	0xb05e99:$: .(shadowUDPHandler).transportUDP 0xb05ed3:$: .(shadowUDPHandler).transportUDP 0xb05f13:$: .(shadowUDPHandler).transportUDP 0xb05f55:$: .(shadowUDPHandler).transportUDP 0xb05fa2:$: .(shadowUDPHandler).transportUDP 0xb05fe2:$: .(shadowUDPHandler).transportUDP 0xb01d50:$: .(quicCipherConn).decrypt 0xb07e60:$: .(mtlsTransporter).Handshake 0xb07e96:$: .(mtlsTransporter).Handshake 0xb07ed7:$: .(mtlsTransporter).Handshake 0xb033cf:$: .(*FIFOStrategy).Apply 0x821105:$: .dnsTCPExchanger 0xb0a6b8:$: .dnsTCPExchanger 0x824c64:$: .dohResponseWriter 0xb0a9c4:$: .dohResponseWriter 0xb0b3dd:$: .dohResponseWriter 0xb0b444:$: .dohResponseWriter 0xb0b4a9:$: .dohResponseWriter 0x82c67d:$: .tcpRemoteForwardListener 0x863482:$: .tcpRemoteForwardListener 0xb0a989:$: .tcpRemoteForwardListener

Joe Sandbox Signatures

Click to jump to signature section

Show All Signature Results

AV Detection

Antivirus / Scanner detection for submitted sample

Source: g.elf

Avira: detected

Multi AV Scanner detection for submitted file

Source: g.elf

Virustotal: Detection: 12%

Perma Link

Source: global traffic	TCP traffic: 192.168.2.23:43928 -> 91.189.91.42:443
Source: global traffic	TCP traffic: 192.168.2.23:42836 -> 91.189.91.43:443
Source: global traffic	TCP traffic: 192.168.2.23:42516 -> 109.202.202.202:80

Source: unknown	TCP traffic detected without corresponding DNS query: 91.189.91.42
Source: unknown	TCP traffic detected without corresponding DNS query: 91.189.91.43
Source: unknown	TCP traffic detected without corresponding DNS query: 109.202.202.202
Source: unknown	TCP traffic detected without corresponding DNS query: 91.189.91.42
Source: unknown	TCP traffic detected without corresponding DNS query: 91.189.91.43
Source: unknown	TCP traffic detected without corresponding DNS query: 109.202.202.202
Source: unknown	TCP traffic detected without corresponding DNS query: 91.189.91.42

Source: g.elf	String found in binary or memory: https://github.com/quic-go/quic-go/wiki/LoggingDisabling
Source: g.elf	String found in binary or memory: https://github.com/quic-go/quic-go/wiki/UDP-Buffer-Sizes

Source: unknown	Network traffic detected: HTTP traffic on port 43928 -> 443
Source: unknown	Network traffic detected: HTTP traffic on port 42836 -> 443

System Summary

Malicious sample detected (through community Yara rule)

Source: g.elf, type: SAMPLE

Matched rule: Detects GOST Go Tunnel, based on strings Author: Sekoia.io

Source: ELF static info symbol of initial sample

.symtab present: no

Source: g.elf, type: SAMPLE

Matched rule: tool_gost_tunnel_strings author = Sekoia.io, description = Detects GOST Go Tunnel, based on strings, creation_date = 2023-02-28, classification = TLP:CLEAR, version = 1.0, id = 2de7aae9-9cf8-4007-aa27-5caea4123713

Source: classification engine

Classification label: mal64.linELF@0/0@0/0

Source: ELF file section

Submission: g.elf

Source: /tmp/g.elf (PID: 6226)

Queries kernel information via 'uname':

Jump to behavior

Source: g.elf, 6226.1.00005611372d8000.00005611375b3000.rw-.sdmp	Binary or memory string: /etc/qemu-binfmt/mipsel
Source: g.elf	Binary or memory string: max=scav ptr ] = (trap:init ms, r0 r1 r2 r3 r4 r5 r6 r7 r8 r9 r10 r11 r12 r13 r14 r15 r16 r17 r18 r19 r20 r21 r22 r23 r24 r25 r26 r27 r28 r29 r30 r31 pc link lo hi fault and tab= top=[...], fp:blockmutexdebug1562578125MarchAprilmonthLocalSHA-1P-224P-256P-384P-521int16int32int64uint8sliceGreekAdlamBamumBatakBuhidDograKhmerLatinLimbuNushuOghamOriyaOsageRunicTakriTamil (at no IPdenyClassRetryfcntl%d %dQUERYED448OtherISPKIAFSDBCSYNCDHCIDDNAMEEUI48EUI64HINFOHTTPSMAILAMAILBMINFONAPTRNINFONSEC3RRSIGSSHFPUINFOCLASSdns: udp: (%s)errorobfs4localmuxershellioctlvsockutf-8%s*%dtext/Realmbad nM=%d %q:%qcountdelayspace%v:%v%v%s @ %vDot1QPPPoEEAPOLPFLogDot11SFlowVXLANpointcoviadnsixdixieidentepmaps-netmailqvmnetxdmcpunifyauditmumpsdbaseuarpsbhfhsmanetbhmdsvslmprtspstexarzservbh611nsrmpis99cis99smeta5netcpgeniedecaponmuxsmptedsfgwalpesss7nsavianxvttpsnareloginntalkutimeripngtimedtemponntpsmetersonarvemmiginadldapsrushdelcsdtbrpfnetgwrfileiscsirsyncnsstpafrogfpitpneod1neod2kioskjstelff-smobrpdrootdblazevchataliasrsf-1dmidiipcd3kazaahuskyrxmonewallqubesre101sbookftsrvmimergv-usus-gvmollybytexsaismoc-lmpipes3l-l1msimsradiosg-lmcvmoncnhrpcft-0cft-1cft-2cft-3cft-4cft-5cft-6cft-7femishellommpftetftpswrmileoipspicexmapixaapislushglobetroffrimslshilpmsyncdsatpqencplv-jcbraineyetvqwavevmrdpgtauatvbusasdisdrwcshpssdhpiodemwinnetiqmikeymmcalnetmleapsprdlapsnappdbrefhydraswarmrsmtporionvenusovwdbtsilbspockwillywindbipasssnapdbrucesolvesonuswkarsqotpsalarmuadtcaurisaisesrmlnkpdnetradixrebolqsoftccmadicpv2grubdimprsncu-1ncu-2unite4talkplatoe-netmysqlssripbbarscsms2svnetrnmapxtrmstwcssosdcppacomprsvpjt400nppmpecommtwrpcaztecarcpdmc3ssms-lacamacssmpprazorpresssmiletftpsxsynce-mdue-woam-wnnpwdiszicomwsmlbapocdnetehsscansenipnimshagcatapdapadrepppsmsiconpsmwanbv-isbv-dssuucpcppdptripeiRAPPewdgsxtguiaccelg2tagxgridtigv2starsthrtxoidsragslbaltcpjoostpcoipwellohttpxsieveazetiitoseslsccfoundupdogsarissf-lmmsfrslightacterspikeipfixsicctspocpsimonquosawiredlutaplutcpbonesmuninwinfstexaicsrpcvtsasayiyaaol-1aol-2aol-3nomad3exmpperfdeenetstunsllmnrmcntpsdmmpa1-bsninafbeorlflcrsamqpsncxcpomsdkicmpdcpdlcads-cwsmannuxslcvsupssdtpqmtpssflowredissvdrpmcftpovsdbosautacnetgraspvmsvcfodmsxmpv7neo4jovbusacpltsimcovstatq3adeirdmid-s-nitachiminkgolemswa-1swa-2swa-3swa-4glrpcwebsmgrcmpinsisvracerobixxmms2sapv1odnsprxapifamdcswdtpcosirhelixirisaweavedicomsmsqpcawashivepitalkbpdbmvnetdnomdbbmdssicppshydap3linkfmsasetb4jsgcipiclidgv-pfigridtrackbinkpquakescscpnxlmdndmpsovobsxqosdkitimsruthcandpasmpsinedowinrmnusrpngr-taboutxribsnacnlvxlankdnetcoapsbabels-bfdaesopghvpn2pingalfindomiqnfapisgsapsbcapslmapnq-apReplyOffer(end)RenewIA_NAIA_TAS46BRQuery%s=%xQuietU-PID%.1f AbortPrismE.163HelloNoiseOFDM,Ghz2,Ghz5,GFSK,FRAG,NoACKStateH.248H.323SIMCOPRACKREFERCCNewAlertFatalERROR0-RTT1-RTTsetnsFlushWriteSuperAnyOfsuperundefmatchrune 2.12.0mipslesecurecipherbypassprefer0x%04XX25519%w%.0wtls13 , not objectnumberstring\ufffdStringFormat[]bytenetdnsdomaingophertelne
Source: g.elf, 6226.1.00005611372d8000.00005611375b3000.rw-.sdmp	Binary or memory string: V!/etc/qemu-binfmt/mipsel
Source: g.elf	Binary or memory string: ClassRetryfcntl%d %dQUERYED448OtherISPKIAFSDBCSYNCDHCIDDNAMEEUI48EUI64HINFOHTTPSMAILAMAILBMINFONAPTRNINFONSEC3RRSIGSSHFPUINFOCLASSdns: udp: (%s)errorobfs4localmuxershellioctlvsockutf-8%s*%dtext/Realmbad nM=%d %q:%qcountdelayspace%v:%v%v%s @ %vDot1QPPPoEEAPOLPFLogDot11SFlowVXLANpointcoviadnsixdixieidentepmaps-netmailqvmnetxdmcpunifyauditmumpsdbaseuarpsbhfhsmanetbhmdsvslmprtspstexarzservbh611nsrmpis99cis99smeta5netcpgeniedecaponmuxsmptedsfgwalpesss7nsavianxvttpsnareloginntalkutimeripngtimedtemponntpsmetersonarvemmiginadldapsrushdelcsdtbrpfnetgwrfileiscsirsyncnsstpafrogfpitpneod1neod2kioskjstelff-smobrpdrootdblazevchataliasrsf-1dmidiipcd3kazaahuskyrxmonewallqubesre101sbookftsrvmimergv-usus-gvmollybytexsaismoc-lmpipes3l-l1msimsradiosg-lmcvmoncnhrpcft-0cft-1cft-2cft-3cft-4cft-5cft-6cft-7femishellommpftetftpswrmileoipspicexmapixaapislushglobetroffrimslshilpmsyncdsatpqencplv-jcbraineyetvqwavevmrdpgtauatvbusasdisdrwcshpssdhpiodemwinnetiqmikeymmcalnetmleapsprdlapsnappdbrefhydraswarmrsmtporionvenusovwdbtsilbspockwillywindbipasssnapdbrucesolvesonuswkarsqotpsalarmuadtcaurisaisesrmlnkpdnetradixrebolqsoftccmadicpv2grubdimprsncu-1ncu-2unite4talkplatoe-netmysqlssripbbarscsms2svnetrnmapxtrmstwcssosdcppacomprsvpjt400nppmpecommtwrpcaztecarcpdmc3ssms-lacamacssmpprazorpresssmiletftpsxsynce-mdue-woam-wnnpwdiszicomwsmlbapocdnetehsscansenipnimshagcatapdapadrepppsmsiconpsmwanbv-isbv-dssuucpcppdptripeiRAPPewdgsxtguiaccelg2tagxgridtigv2starsthrtxoidsragslbaltcpjoostpcoipwellohttpxsieveazetiitoseslsccfoundupdogsarissf-lmmsfrslightacterspikeipfixsicctspocpsimonquosawiredlutaplutcpbonesmuninwinfstexaicsrpcvtsasayiyaaol-1aol-2aol-3nomad3exmpperfdeenetstunsllmnrmcntpsdmmpa1-bsninafbeorlflcrsamqpsncxcpomsdkicmpdcpdlcads-cwsmannuxslcvsupssdtpqmtpssflowredissvdrpmcftpovsdbosautacnetgraspvmsvcfodmsxmpv7neo4jovbusacpltsimcovstatq3adeirdmid-s-nitachiminkgolemswa-1swa-2swa-3swa-4glrpcwebsmgrcmpinsisvracerobixxmms2sapv1odnsprxapifamdcswdtpcosirhelixirisaweavedicomsmsqpcawashivepitalkbpdbmvnetdnomdbbmdssicppshydap3linkfmsasetb4jsgcipiclidgv-pfigridtrackbinkpquakescscpnxlmdndmpsovobsxqosdkitimsruthcandpasmpsinedowinrmnusrpngr-taboutxribsnacnlvxlankdnetcoapsbabels-bfdaesopghvpn2pingalfindomiqnfapisgsapsbcapslmapnq-apReplyOffer(end)RenewIA_NAIA_TAS46BRQuery%s=%xQuietU-PID%.1f AbortPrismE.163HelloNoiseOFDM,Ghz2,Ghz5,GFSK,FRAG,NoACKStateH.248H.323SIMCOPRACKREFERCCNewAlertFatalERROR0-RTT1-RTTsetnsFlushWriteSuperAnyOfsuperundefmatchrune 2.12.0mipslesecurecipherbypassprefer0x%04XX25519%w%.0wtls13 , not objectnumberstring\ufffdStringFormat[]bytenetdnsdomaingophertelnetlisten.onionndots:sendtoip+netsocketspliceacceptwritevreadatTMPDIRremovewaitidkcp-goHOPOPTServerclosed[rtcp]Basic InErrsInPktsInSegssocks5Date: http/3randomHost: tuntap%s: %v
Source: g.elf, 6226.1.00007ffdccd4a000.00007ffdccd6b000.rw-.sdmp	Binary or memory string: x86_64/usr/bin/qemu-mipsel/tmp/g.elfSUDO_USER=saturninoPATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/snap/binDISPLAY=:1.0XAUTHORITY=/run/user/1000/gdm/XauthoritySUDO_UID=1000TERM=xterm-256colorCOLORTERM=truecolorLOGNAME=rootUSER=rootLANG=en_US.UTF-8SUDO_COMMAND=/bin/bashHOME=/rootMAIL=/var/mail/rootSUDO_GID=1000SHELL=/bin/bash/tmp/g.elf
Source: g.elf, 6226.1.00007ffdccd4a000.00007ffdccd6b000.rw-.sdmp	Binary or memory string: /usr/bin/qemu-mipsel

Mitre Att&ck Matrix

Reconnaissance	Resource Development	Initial Access	Execution	Persistence	Privilege Escalation	Defense Evasion	Credential Access	Discovery	Lateral Movement	Collection	Command and Control	Exfiltration	Impact
Gather Victim Identity Information	Acquire Infrastructure	Valid Accounts	Windows Management Instrumentation	Path Interception	Path Interception	Direct Volume Access	OS Credential Dumping	11 Security Software Discovery	Remote Services	Data from Local System	1 Encrypted Channel	Exfiltration Over Other Network Medium	Abuse Accessibility Features
Credentials	Domains	Default Accounts	Scheduled Task/Job	Boot or Logon Initialization Scripts	Boot or Logon Initialization Scripts	Rootkit	LSASS Memory	Application Window Discovery	Remote Desktop Protocol	Data from Removable Media	1 Application Layer Protocol	Exfiltration Over Bluetooth	Network Denial of Service

Malware Configuration

⊘No configs have been found

Behavior Graph

Hide Legend

Legend:

Process
Signature
Created File
DNS/IP Info
Is Dropped
Number of created Files
Is malicious
Internet

Antivirus, Machine Learning and Genetic Malware Detection

Initial Sample

Source	Detection	Scanner	Label	Link
g.elf	13%	Virustotal		Browse
g.elf	11%	ReversingLabs	Linux.Hacktool.Gost
g.elf	100%	Avira	PUA/GM.PuAgent.CX

Dropped Files

⊘No Antivirus matches

Domains

⊘No Antivirus matches

URLs

⊘No Antivirus matches

Domains and IPs

Contacted Domains

⊘No contacted domains info

URLs from Memory and Binaries

Name	Source	Malicious	Antivirus Detection	Reputation
https://github.com/quic-go/quic-go/wiki/LoggingDisabling	g.elf	false		high
https://github.com/quic-go/quic-go/wiki/UDP-Buffer-Sizes	g.elf	false		high

World Map of Contacted IPs

No. of IPs < 25%
25% < No. of IPs < 50%
50% < No. of IPs < 75%
75% < No. of IPs

Public IPs

IP	Domain	Country	ASN	ASN Name	Malicious
109.202.202.202	unknown	Switzerland	13030	INIT7CH	false
91.189.91.43	unknown	United Kingdom	41231	CANONICAL-ASGB	false
91.189.91.42	unknown	United Kingdom	41231	CANONICAL-ASGB	false

Joe Sandbox View / Context

IPs

Match	Associated Sample Name / URL	SHA 256	Detection	Threat Name	Link	Context
109.202.202.202	kpLwzBouH4.elf	Get hash	malicious	Unknown	Browse	ch.archive.ubuntu.com/ubuntu/pool/main/f/firefox/firefox_92.0%2bbuild3-0ubuntu0.20.04.1_amd64.deb
91.189.91.43	aarch643308.elf	Get hash	malicious	Unknown	Browse
	ARMV7L.elf	Get hash	malicious	Unknown	Browse
	bash.elf	Get hash	malicious	Unknown	Browse
	ARMV5L.elf	Get hash	malicious	Unknown	Browse
	boatnet.mpsl.elf	Get hash	malicious	Mirai	Browse
	cedhat	Get hash	malicious	Kaiji	Browse
	arc.elf	Get hash	malicious	Unknown	Browse
	m68k.elf	Get hash	malicious	Gafgyt, Mirai	Browse
	mips.elf	Get hash	malicious	Mirai	Browse
	sparc.elf	Get hash	malicious	Gafgyt, Mirai	Browse
91.189.91.42	aarch643308.elf	Get hash	malicious	Unknown	Browse
	ARMV7L.elf	Get hash	malicious	Unknown	Browse
	bash.elf	Get hash	malicious	Unknown	Browse
	ARMV5L.elf	Get hash	malicious	Unknown	Browse
	boatnet.mpsl.elf	Get hash	malicious	Mirai	Browse
	cedhat	Get hash	malicious	Kaiji	Browse
	arc.elf	Get hash	malicious	Unknown	Browse
	m68k.elf	Get hash	malicious	Gafgyt, Mirai	Browse
	mips.elf	Get hash	malicious	Mirai	Browse
	sparc.elf	Get hash	malicious	Gafgyt, Mirai	Browse

Domains

⊘No context

ASNs

Match	Associated Sample Name / URL	SHA 256	Detection	Threat Name	Link	Context
CANONICAL-ASGB	aarch643308.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	ARMV7L.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	bash.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	ARMV5L.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	boatnet.mpsl.elf	Get hash	malicious	Mirai	Browse	91.189.91.42
	cedhat	Get hash	malicious	Kaiji	Browse	91.189.91.42
	arc.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	i586.elf	Get hash	malicious	Mirai	Browse	185.125.190.26
	m68k.elf	Get hash	malicious	Gafgyt, Mirai	Browse	91.189.91.42
	spc.elf	Get hash	malicious	Unknown	Browse	185.125.190.26
CANONICAL-ASGB	aarch643308.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	ARMV7L.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	bash.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	ARMV5L.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	boatnet.mpsl.elf	Get hash	malicious	Mirai	Browse	91.189.91.42
	cedhat	Get hash	malicious	Kaiji	Browse	91.189.91.42
	arc.elf	Get hash	malicious	Unknown	Browse	91.189.91.42
	i586.elf	Get hash	malicious	Mirai	Browse	185.125.190.26
	m68k.elf	Get hash	malicious	Gafgyt, Mirai	Browse	91.189.91.42
	spc.elf	Get hash	malicious	Unknown	Browse	185.125.190.26
INIT7CH	aarch643308.elf	Get hash	malicious	Unknown	Browse	109.202.202.202
	ARMV7L.elf	Get hash	malicious	Unknown	Browse	109.202.202.202
	bash.elf	Get hash	malicious	Unknown	Browse	109.202.202.202
	ARMV5L.elf	Get hash	malicious	Unknown	Browse	109.202.202.202
	boatnet.mpsl.elf	Get hash	malicious	Mirai	Browse	109.202.202.202
	cedhat	Get hash	malicious	Kaiji	Browse	109.202.202.202
	arc.elf	Get hash	malicious	Unknown	Browse	109.202.202.202
	m68k.elf	Get hash	malicious	Gafgyt, Mirai	Browse	109.202.202.202
	mips.elf	Get hash	malicious	Mirai	Browse	109.202.202.202
	sparc.elf	Get hash	malicious	Gafgyt, Mirai	Browse	109.202.202.202

JA3 Fingerprints

⊘No context

Dropped Files

⊘No context

Created / dropped Files

⊘No created / dropped files found

Static File Info

General

File type:	ELF 32-bit LSB executable, MIPS, MIPS32 version 1 (SYSV), statically linked, Go BuildID=Fwme_MLpYTEC_5bOJ9Ay/kIQoc1kXkeJfNHDKmF-u/h4gSjH3-WTP6jq_eud8c/EfjVU4ej8Q_77O6cCK6h, stripped
Entropy (8bit):	5.596303623505228
TrID:	ELF Executable and Linkable format (generic) (4004/1) 100.00%
File name:	g.elf
File size:	14'942'391 bytes
MD5:	b6cc75734e37475256f2f96207a4a6e0
SHA1:	e27f901a35aee1be603caccb40e49c81f8e3145d
SHA256:	7a2f1b7505c6e2942f1bbd1a48b35687822c5deb11563008db3217266e84d3d4
SHA512:	22e5a0860ad0ddb38589add979b70f97a94191a022ef0e55ef90e07dc5b03c1306d3d6f24a0cd5e5996e790f3d74ac9c6b9ff09f1c04431a4b7972b4f0acf62e
SSDEEP:	49152:jJ8iwXL4XFqG5kJ9LxSJI9+q5kFrXYL9T6jAXynQ5vS8cyXpqDssG8I08XXI8Vpi:iwgynQP+OqJll
TLSH:	A0E6E705EC852BF6C42C4F7490EAC95522706E144AF14A7A22A1FFDCBC7A2797F4789C
File Content Preview:	.ELF.....................z..4..........P4. ...(.........4...4...4...................................d...d...........................................................@.\.@.\.........................@K..`nR.........Q.td...............................p.......

Static ELF Info

ELF header
Class:	ELF32
Data:	2's complement, little endian
Version:	1 (current)
Machine:	MIPS R3000
Version Number:	0x1
Type:	EXEC (Executable file)
OS/ABI:	UNIX - System V
ABI Version:	0
Entry Point Address:	0xb7a04
Flags:	0x50001004
ELF Header Size:	52
Program Header Offset:	52
Program Header Size:	32
Number of Program Headers:	7
Section Header Offset:	276
Section Header Size:	40
Number of Section Headers:	16
Header String Table Index:	14

Sections

Name	Type	Address	Offset	Size	EntSize	Flags	Flags Description	Align
	NULL	0x0	0x0	0x0	0x0	0x0		0
.text	PROGBITS	0x11000	0x1000	0x7ef3e8	0x0	0x6	AX	4
.rodata	PROGBITS	0x810000	0x800000	0x248a8c	0x0	0x2	A	32
.gnu.attributes	GNU_ATTRIBUTES	0x0	0xa48a90	0x10	0x0	0x0		1
.typelink	PROGBITS	0xa58aa0	0xa48aa0	0x45dc	0x0	0x2	A	32
.itablink	PROGBITS	0xa5d080	0xa4d080	0x1240	0x0	0x2	A	32
.gosymtab	PROGBITS	0xa5e2c0	0xa4e2c0	0x0	0x0	0x2	A	1
.gopclntab	PROGBITS	0xa5e2c0	0xa4e2c0	0x37be80	0x0	0x2	A	32
.go.buildinfo	PROGBITS	0xde0000	0xdd0000	0x11d0	0x0	0x3	WA	16
.noptrdata	PROGBITS	0xde11e0	0xdd11e0	0x54be0	0x0	0x3	WA	32
.data	PROGBITS	0xe35dc0	0xe25dc0	0xed70	0x0	0x3	WA	32
.bss	NOBITS	0xe44b40	0xe34b40	0x328cc0	0x0	0x3	WA	32
.noptrbss	NOBITS	0x116d800	0x115d800	0x199660	0x0	0x3	WA	32
.note.go.buildid	NOTE	0x10f9c	0xf9c	0x64	0x0	0x2	A	4
.shstrtab	STRTAB	0x0	0xe40000	0xb7	0x0	0x0		1
.MIPS.abiflags	MIPS_ABIFLAGS	0x10f84	0xf84	0x18	0x0	0x2	A	8

Program Segments

Type	Offset	Virtual Address	Physical Address	File Size	Memory Size	Entropy	Flags	Flags Description	Align	Section Mappings
PHDR	0x34	0x10034	0x10034	0xe0	0xe0	2.4680	0x4	R	0x10000
NOTE	0xf9c	0x10f9c	0x10f9c	0x64	0x64	5.3835	0x4	R	0x4	.note.go.buildid
LOAD	0x0	0x10000	0x10000	0x7f03e8	0x7f03e8	5.1065	0x5	R E	0x10000	.text .note.go.buildid .MIPS.abiflags
LOAD	0x800000	0x810000	0x810000	0x5ca140	0x5ca140	5.7315	0x4	R	0x10000	.rodata .typelink .itablink .gosymtab .gopclntab
LOAD	0xdd0000	0xde0000	0xde0000	0x64b40	0x526e60	6.1549	0x6	RW	0x10000	.go.buildinfo .noptrdata .data .bss .noptrbss
GNU_STACK	0x0	0x0	0x0	0x0	0x0	0.0000	0x6	RW	0x4
ABIFLAGS	0xf84	0x10f84	0x10f84	0x18	0x18	1.0239	0x4	R	0x8	.MIPS.abiflags

Network Behavior

Network Port Distribution

TCP Packets

Timestamp	Source Port	Dest Port	Source IP	Dest IP
Jan 3, 2025 13:10:09.252497911 CET	43928	443	192.168.2.23	91.189.91.42
Jan 3, 2025 13:10:14.883776903 CET	42836	443	192.168.2.23	91.189.91.43
Jan 3, 2025 13:10:16.419598103 CET	42516	80	192.168.2.23	109.202.202.202
Jan 3, 2025 13:10:30.753643036 CET	43928	443	192.168.2.23	91.189.91.42
Jan 3, 2025 13:10:40.992419004 CET	42836	443	192.168.2.23	91.189.91.43
Jan 3, 2025 13:10:47.135421038 CET	42516	80	192.168.2.23	109.202.202.202
Jan 3, 2025 13:11:11.707931042 CET	43928	443	192.168.2.23	91.189.91.42

System Behavior

Analysis Process: g.elf PID: 6226, Parent PID: 6142

General

Start time (UTC):	12:10:08
Start date (UTC):	03/01/2025
Path:	/tmp/g.elf
Arguments:	/tmp/g.elf
File size:	5773336 bytes
MD5 hash:	0d6f61f82cf2f781c6eb0661071d42d9

Description:	Adversaries may attempt to get a listing of security software, configurations, defensive tools, and sensors that are installed on a system or in a cloud environment. This may include things such as firewall rules and anti-virus. Adversaries may use the information from Security Software Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	Command: Command Execution, Firewall: Firewall Enumeration, Firewall: Firewall Metadata, Process: OS API Execution, Process: Process Creation
Platforms:	Azure AD, Google Workspace, IaaS, Linux, macOS, Office 365, SaaS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may employ a known encryption algorithm to conceal command and control traffic rather than relying on any inherent protections provided by a communication protocol. Despite the use of a secure algorithm, these implementations may be vulnerable to reverse engineering if secret keys are encoded and/or generated within malware samples/configuration files.
Tactics:	Command and Control
Data Sources:	Network Traffic: Network Traffic Content
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may communicate using OSI application layer protocols to avoid detection/network filtering by blending in with existing traffic. Commands to the remote system, and often the results of those commands, will be embedded within the protocol traffic between the client and server.
Tactics:	Command and Control
Data Sources:	Network Traffic: Network Traffic Content, Network Traffic: Network Traffic Flow
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Behavior Section

Behavior Chronological

Disassembly

Uncategorized

Graph

Loading Joe Sandbox Report ...

Warning!

Linux Analysis Report g.elf

Overview

General Information

Detection

Signatures

Classification

General Information

Runtime Messages

Process Tree

Yara Signatures

Initial Sample

Suricata Signatures

Joe Sandbox Signatures

AV Detection

Networking

System Summary

Malware Analysis System Evasion

Mitre Att&ck Matrix

Malware Configuration

Behavior Graph

Antivirus, Machine Learning and Genetic Malware Detection

Initial Sample

Dropped Files

Domains

URLs

Domains and IPs

Contacted Domains

URLs from Memory and Binaries

World Map of Contacted IPs

Public IPs

Joe Sandbox View / Context

IPs

Domains

ASNs

JA3 Fingerprints

Dropped Files

Created / dropped Files

Static File Info

General

Static ELF Info

ELF header

Sections

Program Segments

Network Behavior

Network Port Distribution

TCP Packets

System Behavior

Analysis Process: g.elf PID: 6226, Parent PID: 6142

General

Chronological Activities

Linux Analysis Report
g.elf